SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO07208
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 2.183 Nuclear   Reliability : 1.536
 

Sequence

CDS
ATGCCACATGCCATCCGACTTTGGAATGAGCTTCCCTCCACGGTGTTTCCCGAGCGCTACGACATGTCCTTCTTCAAACAAGATTTGTGGACAGTACTTAACGGTAGGCAGCGGACGTCGCAGCGACGTGCAGATAGCAACGTCGTCTGCGGATTCATCTATGCAGACGACGTTGCTATCTGCACCGAGAGCCGCACAGAGCTACGAGAGGCACTCCTGTTGTGGAAACAGCAGTTACAAGCCGGTGGCCTAATATTGAGTGTTGCGAAGACACATTACATGTCTTTTAATGACCCAGATCCAGGTGACAACAGTCCGATTTCCATTGACGGTCAACTTGTAAACATGTGCGATCAATACAAGTATCTGGGTACTATGATGCACAGATCTGGAAATTTAAAATGCAACATTCAACACCGAATAGCCGCAGCGTGGCTAAAATGGCGAGAAGTAAGTGGTGTCACCTGCGATAGGAGGATGCCCGTTAAGCTCAAGGGTATGATCTATAAGACTATAATAAGGCCTGTTCTTATGTATGGCAGCGAAACATGGGCGGCAACCAAAAGGAACGTACATACCATTCAAGTTGCTGAAATGAAAATGCTGAGGTGGATGTGCGGCGTGACTAGGCTCGATAAAATCCGCAACGAGTACGTGCGTGGAAGTCTAGGTGTACGGGACATCGCCGACAAGATGCAGGAGAGTAGGCTGAGATGGTATGGTCACGTGAAAAGGAAGCCACCTGACTACGTCGGAAATTTGGCGCTACTGCTCGACCTCCCCGGTCGAAGACCTAGAGGCAGACCCAAGACAAGGTGGAGGGACGTAGTGCTGAAGGACAAGAGAGAATGCAATGCTGCTGACGAGGATGTCGAAGACAGAGCGAAGTGGAGGAGTAAAGTCAGGAAAGCTGACCCCACCACCATGTGGGATAAATAG
Protein
MPHAIRLWNELPSTVFPERYDMSFFKQDLWTVLNGRQRTSQRRADSNVVCGFIYADDVAICTESRTELREALLLWKQQLQAGGLILSVAKTHYMSFNDPDPGDNSPISIDGQLVNMCDQYKYLGTMMHRSGNLKCNIQHRIAAAWLKWREVSGVTCDRRMPVKLKGMIYKTIIRPVLMYGSETWAATKRNVHTIQVAEMKMLRWMCGVTRLDKIRNEYVRGSLGVRDIADKMQESRLRWYGHVKRKPPDYVGNLALLLDLPGRRPRGRPKTRWRDVVLKDKRECNAADEDVEDRAKWRSKVRKADPTTMWDK

Summary

Pfam
PF00078   RVT_1
Interpro
IPR000477   RT_dom        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR027124   Swc5/CFDP2       
IPR001229   Jacalin-like_lectin_dom       
IPR036404   Jacalin-like_lectin_dom_sf       
SUPFAM
SSF56219   SSF56219        + More
SSF51101   SSF51101       
Gene 3D
ProteinModelPortal

Ontologies

Topology

Length:
312
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00531
Exp number, first 60 AAs:
0.00105
Total prob of N-in:
0.02261
outside
1  -  312
 
 

Population Genetic Test Statistics

Pi
273.518458
Theta
150.232955
Tajima's D
4.547944
CLR
0
CSRT
0.999950002499875
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号