SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO07194  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA010385
Annotation
PREDICTED:_non-lysosomal_glucosylceramidase-like_isoform_X2_[Bombyx_mori]
Full name
Non-lysosomal glucosylceramidase      
Location in the cell
Mitochondrial   Reliability : 2.108
 

Sequence

CDS
ATGGATATCGAACCCGCAGCCAAAGAACACCGCGATTTTGAAATGGACAAACCATCGAAATTCGGCTTAAAACTTCCCTTAGATCATGAATTTCCCCTGAAGAGCAAGCAGATTATAATTCCAAGACCAAAACAAATACTGGACATGATACCGCTTTCAGTCAGGTATTTCAAGTATTGTTTGAGCAAAAAACTGCGTAAAAGGCGTCCAATAATGGATTATTTCCAAATGATTTCAGCACAGCGAATGTACGGATGTCCCATTGGTGGAATTGGAGGTGGAACCATAGGGAGGGGTTTTAAAGGGGAATTTTGTCGTTTTCAACTACATCCTGGTATATATGAATATGTCACTGTCCCAGAATGCCAGTTTATTGTAAACATAAGGAATGCTAACAATGAGACAATATTCCAATCAGTTCTTTCCACCTACAGCAAACCAAAGAAAGCCCCGGCATCTTGGGAATGGAACCTTGATGGTGCAAAATGTGAATACACAGCACTGTATCCGAGGGCATGGACAACATATGATCTGTCAAAATATGGTGTGAAACTTGTGTGTAGACAAATATCACCAGTAATACCTCATAACTATAAGGACAGCAAGACGTGA
Protein
MDIEPAAKEHRDFEMDKPSKFGLKLPLDHEFPLKSKQIIIPRPKQILDMIPLSVRYFKYCLSKKLRKRRPIMDYFQMISAQRMYGCPIGGIGGGTIGRGFKGEFCRFQLHPGIYEYVTVPECQFIVNIRNANNETIFQSVLSTYSKPKKAPASWEWNLDGAKCEYTALYPRAWTTYDLSKYGVKLVCRQISPVIPHNYKDSKT

Summary

Description
Non-lysosomal glucosylceramidase that catalyzes the hydrolysis of glucosylceramide (GlcCer) to free glucose and ceramide.
Non-lysosomal glucosylceramidase that catalyzes the conversion of glucosylceramide to free glucose and ceramide.
Catalytic Activity
a beta-D-glucosyl-(1<->1')-N-acylsphing-4-enine + H2O = an N-acylsphing-4-enine + D-glucose
Similarity
Belongs to the non-lysosomal glucosylceramidase family.
Keywords
Cell membrane   Complete proteome   Glycoprotein   Glycosidase   Hydrolase   Lipid metabolism   Membrane   Phosphoprotein   Reference proteome   Sphingolipid metabolism   Transmembrane   Transmembrane helix  
Feature
chain  Non-lysosomal glucosylceramidase
EC Number
3.2.1.45
EMBL
BABH01005693    BABH01005694    BABH01005695    BABH01005696    NWSH01000781    PCG74252.1    + More
KQ459603    KPI92767.1    KQ460883    KPJ11193.1    RSAL01000003    RVE54749.1    AGBW02007871    OWR54456.1    CVRI01000074    CRL08234.1    GFDL01015179    JAV19866.1    GGFK01005378    MBW38699.1    JXUM01040103    JXUM01040104    JXUM01040105    JXUM01040106    KQ561232    KXJ79285.1    KQ971354    EFA07388.1    AJVK01002842    AJVK01002843    AJVK01002844    GGFL01004568    MBW68746.1    AJWK01014724    AJWK01014725    AJWK01014726    AJWK01014727    GEZM01041578    JAV80275.1    GEZM01041586    JAV80270.1    UFQT01000222    SSX21962.1    GDRN01092272    GDRN01092271    JAI60136.1    GFDF01001349    JAV12735.1    GFDF01001350    JAV12734.1    NNAY01000010    OXU32049.1    UFQS01000634    UFQT01000634    SSX05588.1    SSX25947.1    GGMR01009796    MBY22415.1    GGMR01004635    MBY17254.1    AAZX01005602    GBXI01008373    JAD05919.1    CH940654    KRF77831.1    GAMC01012127    JAB94428.1    JRES01001125    KNC25310.1    ATLV01018361    ATLV01018362    ATLV01018363    KE525231    KFB42988.1    APCN01003341    APCN01003342    GEZM01041579    JAV80274.1    AAAB01008984    GFXV01005103    MBW16908.1    JXJN01015223    GBXI01016236    JAC98055.1    CH933807    KRG02958.1    GDHF01013840    JAI38474.1    CM000157    KRJ98122.1    GAKP01019748    GAKP01019747    GAKP01019745    GAKP01019744    JAC39207.1    AXCN02000732    JH432114    EAA14848.4    GDHF01031985    JAI20329.1    GAKP01019749    GAKP01019746    JAC39203.1    CH477219    EAT47379.1    CH379061    KRT04860.1    OUUW01000006    SPP82482.1    GAMC01012126    JAB94429.1    CH954177    KQS70445.1    ABLF02018149    ABLF02018157    ABLF02018163    ABLF02059614    DS231884    EDS43066.1    DS235389    EEB15492.1    CH902620    KPU73469.1    APGK01029406    APGK01029407    APGK01029408    APGK01029409    KB740734    ENN79258.1    AE014134    AHN54442.1    CM002910    KMY90235.1    GGMS01006401    MBY75604.1    CH963913    EDW77386.1    GEDC01009404    JAS27894.1    EDW88993.1    GEDC01008565    JAS28733.1    GEDC01025021    JAS12277.1    GEZM01041580    JAV80273.1    GECZ01003088    JAS66681.1    EDY70607.2    KQS70446.1    SPP82483.1    EDV58579.1    AHN54441.1    KMY90234.1    BT024218    BT044085    AY058463    CM000361    EDX05028.1    CH480818    EDW51739.1    KMY90233.1    AXCM01000045    EDV31553.2    PZQS01000013    PVD19748.1    GEBQ01014339    GEBQ01001449    JAT25638.1    JAT38528.1   
Pfam
PF12215   Glyco_hydr_116N        + More
PF04685   DUF608
PF07500   TFIIS_M
PF05422   SIN1
PF16979   SIN1_PH
PF01096   TFIIS_C
PF08711   Med26
PF16978   CRIM
PF10609   ParA
Interpro
IPR024462   GH116_N        + More
IPR012341   6hp_glycosidase-like_sf       
IPR008928   6-hairpin_glycosidase_sf       
IPR006775   GH116_catalytic       
IPR014551   B_Glucosidase_GBA2-typ       
IPR003617   TFIIS/CRSP70_N_sub       
IPR006289   TFSII       
IPR031567   CRIM_dom       
IPR032679   Sin1_N       
IPR017923   TFIIS_N       
IPR001222   Znf_TFIIS       
IPR003618   TFIIS_cen_dom       
IPR011993   PH-like_dom_sf       
IPR036575   TFIIS_cen_dom_sf       
IPR035441   TFIIS/LEDGF_dom_sf       
IPR031313   Sin1_PH_dom       
IPR019591   Mrp/NBP35_ATP-bd       
IPR027417   P-loop_NTPase       
IPR033756   YlxH/NBP35       
IPR000808   Mrp_CS       
SUPFAM
SSF48208   SSF48208        + More
SSF46942   SSF46942       
SSF47676   SSF47676       
SSF52540   SSF52540       
PDB
5OST     E-value=8.69048e-10,     Score=149

Ontologies

Topology

Subcellular location
Nucleus  
Cell membrane  
Length:
203
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.951
Exp number, first 60 AAs:
0.01038
Total prob of N-in:
0.12224
outside
1  -  203
 
 

Population Genetic Test Statistics

Pi
15.774678
Theta
14.593288
Tajima's D
-0.911977
CLR
3.114168
CSRT
0.156442177891105
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号