SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO07193  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA010385
Annotation
PREDICTED:_non-lysosomal_glucosylceramidase-like_isoform_X2_[Bombyx_mori]
Full name
Non-lysosomal glucosylceramidase      
Location in the cell
Cytoplasmic   Reliability : 2.187 Nuclear   Reliability : 1.609
 

Sequence

CDS
ATGAATAAAATCGATTTGGAAAGGTATTCTGAGGACTATACGTGCGGAGTTTCGTTAGAGCAAAGAATCGGCGAAAGCTTATGTACGTTTACGATAGCGAAAAAGAAAGTCGATGACGAAACGATCCACCAGGGCTATTGCCTGTGGAACGCGGCGAAGACTTCCAACTACGTTTGGGAATGCATAAAGAAAGATGGGAAGCTAACTCCGGATCCAAACTTAACTCCACCGCCGCCCAAACTTCCCGACAAAGACGCACAAAAGAAAAAGAAAGACAAAGAAAAAAAGAAACTGTATAAATGTGATTCAGTCGCCCTGTCCAGCGTCATATCGTTAGATCCAGGGGGAGTTAGTTCAACGGAGTTTTGTCTGGCCTGGGATATGCCTGTAGTTAAATATAGAAACGACAAAAAAATTCACAGAAGATTTTACACGAAATATTTTGGTAGTGACGGCATAGCCGGTGCGAGCATAGCTGCCTACGCTCTAAAGCATTACAAAAATTGGGAAAAACAGCTTCTTGAATGGCAGGAGCCAATTTTAACTAATTACAATATACCAGACTGGTTGAAAAGTGCCTTAATGAACGAGCTTTATTTTGTCGCCGATGGCGGAACGATTTGGTTTGATGCAAGCGACGAATTTCCAGAAACGGATCCTAGGTAA
Protein
MNKIDLERYSEDYTCGVSLEQRIGESLCTFTIAKKKVDDETIHQGYCLWNAAKTSNYVWECIKKDGKLTPDPNLTPPPPKLPDKDAQKKKKDKEKKKLYKCDSVALSSVISLDPGGVSSTEFCLAWDMPVVKYRNDKKIHRRFYTKYFGSDGIAGASIAAYALKHYKNWEKQLLEWQEPILTNYNIPDWLKSALMNELYFVADGGTIWFDASDEFPETDPR

Summary

Description
Non-lysosomal glucosylceramidase that catalyzes the hydrolysis of glucosylceramide (GlcCer) to free glucose and ceramide.
Catalytic Activity
a beta-D-glucosyl-(1<->1')-N-acylsphing-4-enine + H2O = an N-acylsphing-4-enine + D-glucose
Similarity
Belongs to the non-lysosomal glucosylceramidase family.
EC Number
3.2.1.45
Pfam
PF04685   DUF608        + More
PF12215   Glyco_hydr_116N
Interpro
IPR012341   6hp_glycosidase-like_sf        + More
IPR008928   6-hairpin_glycosidase_sf       
IPR006775   GH116_catalytic       
IPR024462   GH116_N       
IPR014551   B_Glucosidase_GBA2-typ       
SUPFAM
SSF48208   SSF48208       
Gene 3D
PDB
5OST     E-value=1.71818e-18,     Score=224

Ontologies

Topology

Length:
221
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
2.71859
Exp number, first 60 AAs:
0.00037
Total prob of N-in:
0.25037
outside
1  -  221
 
 

Population Genetic Test Statistics

Pi
50.045779
Theta
83.931124
Tajima's D
-1.170216
CLR
76.870641
CSRT
0.107944602769862
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号