SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO07146  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA010403
Annotation
mitochondrial_aldehyde_dehydrogenase_[Bombyx_mori]
Location in the cell
Cytoplasmic   Reliability : 1.376
 

Sequence

CDS
ATGGTGAAAGTAGACGTCAAGTACACTAAGCTATTTATCAACAATGAATGGGTAGATGCTGTCAGCAAAAAAACCTTCCCTACCATCAACCCACAAGATGAAACAGTCATAACACAGGTCGCTGAAGGAGATAAGGCGGATATTGATTTGGCCGTCGCCGCAGCAAAGAAAGCATTCCACCGTTATTCCCCATGGCGTACCATGGACGCTTCTCAACGCGGCCTCCTATTGCTTAAGCTAGCCGAACTTCTAGAATCCCAATCTAGATACCTAGCTGAGCTAGAGACTTTAGACTGTGGAAAACCGGTAAAACAATCCGAAGAAGAAGTATACTTTTCCGCAAGCGTGCTCAGATATTACGCTGGAAAAGCGGACAAGATATTAGGAAATACCATTCCTTCAGACGGAGAAGTCCTTACGTTCACCATGAAGGAGCCTGTCGGAGTGTGCGGTCAGATAATACCGTGGAATTACCCCATACCAATGATGTCTTGGAAAATAGCACCAGCCTTAGCTGCAGGATGTACCGTTGTTCTGAAGCCAGCTGAACAAACACCGCTGACTGCGCTCGCTGTTGCCGCCCTGGTCAAAGAAGCGGGCTTTCCACCGGGGGTTGTCAATGTCGTTCCCGGATACGGTGCGACAGCGGGCGGTGCTCTTACTCACCACCCAGATGTTGACAAAATCGCTTTCACTGGCTCCACTGAGGTATACTTTTTTTCTATTGCTTAG
Protein
MVKVDVKYTKLFINNEWVDAVSKKTFPTINPQDETVITQVAEGDKADIDLAVAAAKKAFHRYSPWRTMDASQRGLLLLKLAELLESQSRYLAELETLDCGKPVKQSEEEVYFSASVLRYYAGKADKILGNTIPSDGEVLTFTMKEPVGVCGQIIPWNYPIPMMSWKIAPALAAGCTVVLKPAEQTPLTALAVAALVKEAGFPPGVVNVVPGYGATAGGALTHHPDVDKIAFTGSTEVYFFSIA

Summary

Similarity
Belongs to the aldehyde dehydrogenase family.
Belongs to the protein disulfide isomerase family.
EMBL
BABH01005570    BABH01005571    BABH01005572    BABH01005573    DQ311283    ABD36228.1    + More
KQ459603    KPI92727.1    EZ407197    ACX53758.1    KQ460883    KPJ11229.1    KPJ11230.1    NWSH01001358    PCG71550.1    ODYU01004657    SOQ44774.1    JTDY01000429    KOB77219.1    ODYU01002733    SOQ40599.1    AGBW02013442    OWR43436.1    AGBW02013494    OWR43337.1    EZ407188    ACX53749.1    DS232392    EDS41034.1    GGFK01006088    MBW39409.1    GGFK01006020    MBW39341.1    LJIJ01000295    ODM99179.1    GAMD01003251    JAA98339.1    AXCN02000654    JXUM01078869    KQ563093    KXJ74487.1    CVRI01000006    CRK88023.1    CH477625    EAT38124.1    GAPW01001149    JAC12449.1    KQ971326    EEZ97369.1    GFDL01008464    JAV26581.1    EU106624    ABU97475.1    ADMH02000539    ETN66060.1    GFAH01000487    JAV47902.1    AEFK01074650    APCN01001694    NOWV01000103    RDD40389.1    AAAB01008980    EAA14068.3    RDD40374.1    CVRI01000066    CRL06284.1    DS985243    EDV26543.1    KX060612    AOD75396.1    AY291328    AAQ24547.1    GDIQ01148387    JAL03339.1    GGMS01014351    MBY83554.1    KQ434820    KZC07026.1    MH979760    AYV89215.1    JH817012    EKC37583.1    NTJE010061653    MBV97550.1    AAGJ04009886    AAGJ04009887    MH990439    AYV88986.1    EKC37584.1    NCKU01002086    RWS10468.1    GCES01158808    JAQ27514.1    NEDP02004706    OWF44662.1    AY283296    AAP35081.1    KB202567    ESO89599.1    KB320515    ELW69851.1    KY679131    AVR59242.1    NIVC01002449    PAA57759.1    NIVC01002372    PAA58467.1    NIVC01000222    PAA87659.1    GG666469    EEN67897.1    GCES01044211    JAR42112.1    GL765283    EFZ16677.1    GCES01044212    JAR42111.1    JH000194    EGW07916.1    EDV26544.1    AC133299    CH473962    EDL98822.1    LZPO01107946    OBS59865.1    GDIP01066067    JAM37648.1    AGTP01043698    KK114785    KFM63313.1    GL439158    EFN67709.1    GBSI01000206    JAC96289.1    AAQR03033261    GDIP01220392    JAJ03010.1    GGMS01001617    MBY70820.1    AAEX03007973    GDIP01238190    JAI85211.1    GALX01004368    JAB64098.1   
Pfam
PF00171   Aldedh        + More
PF00085   Thioredoxin
Interpro
IPR016161   Ald_DH/histidinol_DH        + More
IPR016163   Ald_DH_C       
IPR016160   Ald_DH_CS_CYS       
IPR029510   Ald_DH_CS_GLU       
IPR016162   Ald_DH_N       
IPR015590   Aldehyde_DH_dom       
IPR036249   Thioredoxin-like_sf       
IPR005788   Disulphide_isomerase       
IPR013766   Thioredoxin_domain       
IPR017937   Thioredoxin_CS       
SUPFAM
SSF53720   SSF53720        + More
SSF52833   SSF52833       
Gene 3D
PDB
1AG8     E-value=1.50898e-62,     Score=605

Ontologies

Topology

Length:
243
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.18131
Exp number, first 60 AAs:
0
Total prob of N-in:
0.27851
outside
1  -  243
 
 

Population Genetic Test Statistics

Pi
215.558087
Theta
165.10144
Tajima's D
0.502949
CLR
0.837497
CSRT
0.512624368781561
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
26280517 EKISSMPVGGGAPAAAAAAAPAAAAAEEK 100.00 1e-11
25044914 EPTAEVESNETKQ 100.00 1e-11
26280517 DYGEKDNEVIAK 95.83 9e-10
26280517 KSFYPTQEK 100.00 7e-09
25044914 KTFGVPIAR 100.00 7e-09
26280517 TFIGTFK 100.00 3e-08
25044914 TFPICTIANTPR 100.00 3e-08
31223520 YLAELETLDCGKPVK 100.00 2e-06
31223520 IAREEIFGPVQSILK 100.00 2e-04
31223520 ELGEDGISQYLETK 100.00 8e-04
31223520 SPLVVFNDADVEK 100.00 0.003
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号