SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO07120
Annotation
PREDICTED:_anoctamin-5-like_[Papilio_machaon]
Location in the cell
Cytoplasmic   Reliability : 1.18 Mitochondrial   Reliability : 1.476 Nuclear   Reliability : 1.057
 

Sequence

CDS
ATGTTCAATAACAGGCACTGGGTATTCCAACAAGATTCGGCGCCAGCTCATAGAGCGAAGAGCACACAAGACTGGCTGGCGGCGCGTGAAATCGACTTCATCCGGCACGAAGACTGGCAGTCCAGATTTGAATCCGTTAGATTACAAGATATGGCAACACTTGGAGGAAAAGGCGTGCTCAAAGCCTCATCCCAATTTGGAGTCACTCAAGACATCCTTGATTAA
Protein
MFNNRHWVFQQDSAPAHRAKSTQDWLAAREIDFIRHEDWQSRFESVRLQDMATLGGKGVLKASSQFGVTQDILD

Summary

Pfam
PF13358   DDE_3        + More
PF00292   PAX
Interpro
IPR038717   Tc1-like_DDE_dom        + More
IPR009057   Homeobox-like_sf       
IPR001523   Paired_dom       
IPR036388   WH-like_DNA-bd_sf       
SUPFAM
SSF46689   SSF46689       
Gene 3D

Ontologies

Topology

Length:
74
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00077
Exp number, first 60 AAs:
0.00037
Total prob of N-in:
0.39116
outside
1  -  74
 
 

Population Genetic Test Statistics

Pi
214.676921
Theta
124.451931
Tajima's D
2.276556
CLR
0
CSRT
0.92110394480276
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号