SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO06903
Annotation
PREDICTED:_uncharacterized_protein_LOC101738214_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 3.74
 

Sequence

CDS
ATGGATAAACAAACAACAACCCTAACAGATTCAATCACAAAAGCGGTATTGAAAAAAATGGATGATAAGTTAACACCAATTATAGAAGAAAATTTGTTTCTAAAGAATGAAGTAGAGAAATTAAATGAGAAAGTAAAACGCCTAGAATTTGGTAAAAAGGAGAATAATTCAATACTCTACGGCTTCGAGGAATCGAATGAACATATTAACATAGTGGAAATGGTATCAAAAACTTTAAGCGATTCGGGTATCGAAGTGCATAAAACAGATATTAACAAAGCGTTTAGAATTGGTAAAGTAAAAGAAAAAGCACGCCCAATTTTAATTAATATGCTAAACGCATGGAAGAGAGATGAGATTTTGCGAAATAAGAAAAAGCTGCCAAAAAATATTTATGTTAAAGAGGATTTCAGTAAAGAAGTTTTAGAAAGAAGGAAAGAACTAATACCGCATTTAAAGGAAGAACGAAAAAAGGGACGTATAGCATACATAAAATACGACAAACTAGTTGTTGAAGGTGAAGCAAGTGGGATGCGAGATAAAAGGAAGAGAGACCAATCTGCCTCACCAAAGACAAAGAATGACACTGAAAACGCCCCGACAAAAGTAAACAAAATAAATGCCTTCGAAAAGATGTATAGAATTTAA
Protein
MDKQTTTLTDSITKAVLKKMDDKLTPIIEENLFLKNEVEKLNEKVKRLEFGKKENNSILYGFEESNEHINIVEMVSKTLSDSGIEVHKTDINKAFRIGKVKEKARPILINMLNAWKRDEILRNKKKLPKNIYVKEDFSKEVLERRKELIPHLKEERKKGRIAYIKYDKLVVEGEASGMRDKRKRDQSASPKTKNDTENAPTKVNKINAFEKMYRI

Summary

EMBL
ODYU01013311    SOQ60019.1    NWSH01004020    PCG65566.1    NWSH01001196    PCG72157.1    + More
JTDY01002536    KOB71226.1    NWSH01003397    PCG66369.1    NWSH01002532    PCG68054.1    NWSH01005231    PCG64345.1    NWSH01001771    PCG70189.1    JTDY01003098    KOB70157.1    ODYU01000585    SOQ35630.1    ODYU01000586    SOQ35631.1    NWSH01003169    PCG66835.1    KZ150150    PZC72845.1    GDQN01002055    GDQN01002009    JAT88999.1    JAT89045.1    JTDY01001071    KOB74965.1    NWSH01000260    PCG77926.1    JTDY01000539    KOB76734.1    FJ265564    ADI61832.1    BABH01021795    JTDY01000743    KOB76037.1    JTDY01000511    KOB76839.1    KZ149976    PZC75915.1    ODYU01001637    SOQ38140.1    JTDY01008572    KOB64508.1    JTDY01001949    KOB72466.1    JTDY01007450    KOB65190.1    JTDY01000484    KOB76970.1    BABH01024878    JTDY01009161    KOB64038.1    JTDY01007191    KOB65392.1    JTDY01000408    KOB77334.1    GEZM01039814    JAV81166.1    GBGD01002698    JAC86191.1    JTDY01002701    KOB70892.1    JTDY01016948    KOB51874.1    KQ459995    KPJ18566.1    GEZM01082533    JAV61335.1    FJ265563    ADI61831.1    GFTR01003558    JAW12868.1    JTDY01010650    KOB58126.1    JTDY01002685    KOB70933.1    JTDY01000076    KOB79001.1    JTDY01000843    KOB75692.1    NWSH01001568    PCG70835.1    ODYU01010663    SOQ55918.1    JTDY01008567    KOB64512.1    JTDY01000977    KOB75230.1    JTDY01010526    KOB58179.1    JTDY01000895    KOB75518.1   
Pfam
PF14529   Exo_endo_phos_2        + More
PF00078   RVT_1
Interpro
IPR036691   Endo/exonu/phosph_ase_sf        + More
IPR027124   Swc5/CFDP2       
IPR005135   Endo/exonuclease/phosphatase       
IPR000477   RT_dom       
IPR004244   Transposase_22       
IPR001680   WD40_repeat       
IPR015943   WD40/YVTN_repeat-like_dom_sf       
IPR011990   TPR-like_helical_dom_sf       
IPR036322   WD40_repeat_dom_sf       
SUPFAM
SSF56219   SSF56219        + More
SSF50978   SSF50978       
Gene 3D

Ontologies

Topology

Length:
215
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0
Exp number, first 60 AAs:
0
Total prob of N-in:
0.39094
outside
1  -  215
 
 

Population Genetic Test Statistics

Pi
2.724303
Theta
6.594736
Tajima's D
-1.566738
CLR
930.548056
CSRT
0.047797610119494
Interpretation
Possibly Positive selection

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号