SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO06732  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA011746
Annotation
DEAD_box_polypeptide_5_isoform_2_[Bombyx_mori]
Location in the cell
Cytoplasmic   Reliability : 1.045 Nuclear   Reliability : 1.347
 

Sequence

CDS
ATGGGTTACAAAGAACCGACGCCCATTCAAGCTCAAGGCTGGCCGATAGCTATGTCTGGAAAGAATTTAGTTGGCGTAGCCCAAACGGGTTCCGGCAAAACGTTGGCCTACATCTTGCCAGCCATTGTGCACATAAACAACCAACCGCCTATTCGGAGAGGTGATGGTCCGATTGCTTTGGTCTTGGCGCCTACCAGAGAGTTAGCACAACAAATTCAGCAAGTTGCTGCAGATTTTGGACACACATCTTATGTTCGTAACACGTGTGTGTTTGGTGGTGCTCCTAAAAGAGAGCAAGCCCGGGACTTGGAGAGGGGAGTAGAAATAGTCATTGCTACTCCAGGTAGATTAATTGATTTCTTGGAAAAGGGCACAACCAACTTACAGCGGTGCACATATTTAGTTCTTGATGAGGCTGATCGTATGTTGGATATGGGATTTGAACCACAAATCAGAAAAATCATTGAGCAAATACGCCCAGACAGACAGACTTTGATGTGGTCAGCTACTTGGCCCAAAGAAGTGAAGAAACTTGCTGAGGATTACTTGGGAGACTACATTCAGATCAATATAGGATCATTACAACTTTCCGCAAATCACAACATTCTTCAAATTGTAGATATTTGTCAAGAACATGAAAAAGAAAATAAATTAAATGTATTATTGCAAGAAATTGGACAAAGTCAAGAACCTGGTGCGAAAACAATAATTTTTGTTGAAACCAAGAGAAAAGCTGAGAACATATCAAGGAACATAAGGAGATATGGCTGGCCAGCTGTTTGCATGCATGGCGATAAAACTCAACAAGAAAGAGATGAAGTTCTGTATCAGTTCAAGGAAGGTCGTGCTAGTATTCTTGTAGCAACTGATGTTGCAGCTCGAGGGCTTGATGTTGATGGTATCAAATATGTAATAAATTTTGATTATCCAAATTCGTCGGAGGATTACATCCATCGTATTGGGAGAACTGGACGTTCAAAATCAAAAGGAACATCATATGCTTTCTTTACCCCTTCAAATTCCCGTCAAGCCAAAGATTTGGTATCTGTTCTACAAGAAGCTAATCAGATTATTAGCCCACAACTGCAGTCGATGGCCGACCGTTGCGGTGGTGGTGGCGGCGGGTGGAACAGGAACAGATTCGGCGGAGGTGGACGAGGTGGTGGCGGCTCTTTTAAACGCGGAAGCAATTTTGGCAAGAGTAGCCAAAGGGGGGGCAGTGGTTACAAACGATTTGACGACTATTAA
Protein
MGYKEPTPIQAQGWPIAMSGKNLVGVAQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIATPGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINIGSLQLSANHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRKAENISRNIRRYGWPAVCMHGDKTQQERDEVLYQFKEGRASILVATDVAARGLDVDGIKYVINFDYPNSSEDYIHRIGRTGRSKSKGTSYAFFTPSNSRQAKDLVSVLQEANQIISPQLQSMADRCGGGGGGWNRNRFGGGGRGGGGSFKRGSNFGKSSQRGGSGYKRFDDY

Summary

Similarity
Belongs to the DEAD box helicase family.
EMBL
DQ443224    ABF51313.1    BABH01011897    DQ443223    ABF51312.1    ODYU01012134    + More
SOQ58265.1    KQ459606    KPI91689.1    NWSH01000021    PCG80697.1    AB264678    BAG30754.1    AK404897    BAM20360.1    KQ460499    KPJ14287.1    MG846898    AXY94750.1    AGBW02010142    OWR49088.1    JTDY01008184    KOB64694.1    GAIX01003907    JAA88653.1    KQ973453    KXZ75521.1    LJIG01022795    KRT78682.1    GEZM01068283    JAV67047.1    GEZM01068282    JAV67048.1    GALX01002844    JAB65622.1    KXZ75522.1    NNAY01000614    OXU27383.1    AAZX01007814    LJIG01022617    KRT79603.1    APGK01057722    KB741280    KB632170    ENN71022.1    ERL89521.1    KQ434978    KZC13005.1    GALX01004619    JAB63847.1    KB632352    ERL93297.1    KK853035    KDR12221.1    FX985707    BBA84445.1    GALX01003064    JAB65402.1    KK852729    KDR17554.1    NEVH01016301    PNF25859.1    KB632390    ERL94437.1    NEVH01026401    PNF14191.1    KDR17563.1    PYGN01000211    PSN51101.1    PNF14190.1    NNAY01004047    OXU18442.1    PCG80698.1    KQ414851    KOC60199.1    PCG80699.1    PNF25833.1    KZ288518    PBC25101.1    JR036778    AEY57392.1    JR036777    AEY57391.1    KQ414666    KOC65111.1    KQ435693    KOX81002.1    KQ434829    KZC07755.1    LRGB01001581    KZS11494.1    GL732558    EFX78251.1    KZ288186    PBC34810.1    JR050357    AEY61249.1    DS235269    EEB14097.1    GDIP01148155    JAJ75247.1    GL768105    EFZ12253.1    GDIP01112144    JAL91570.1    GDIP01043664    JAM60051.1    GDIP01072458    JAM31257.1    GDIP01142344    JAL61370.1    GDIP01096415    JAM07300.1    GEDC01012518    JAS24780.1    KQ971329    EFA01112.2    LBMM01002449    KMQ94815.1    KK116065    KFM66710.1    GDIP01043665    JAM60050.1    GAMC01014331    JAB92224.1    GDIP01051760    JAM51955.1    GDIP01019708    JAM84007.1    GDIP01043396    JAM60319.1    GDIQ01145033    JAL06693.1    GDIP01239145    JAI84256.1    GDIQ01037356    JAN57381.1    GEDC01031146    JAS06152.1    GAKP01006259    JAC52693.1    GAKP01006260    JAC52692.1    GDIQ01115740    JAL35986.1    GDIQ01226493    JAK25232.1    GDIP01186697    JAJ36705.1    KK107024    EZA62250.1    KQ977890    KYM98981.1    GL445250    EFN89962.1    ADTU01020334    ADTU01020335    ADTU01020336    ADTU01020337    KQ982584    KYQ54410.1    KQ979011    KYN26621.1    GL888190    EGI65460.1    KZ288268    PBC30052.1    KQ981652    KYN38639.1    ADTU01006523    GDIP01094044    JAM09671.1    GDIP01230427    JAI92974.1    GEDC01020087    JAS17211.1    QOIP01000004    RLU23439.1    GL763868    EFZ19232.1    KQ981852    KYN34965.1   
Pfam
PF00270   DEAD        + More
PF00271   Helicase_C
PF01585   G-patch
PF01728   FtsJ
Interpro
IPR027417   P-loop_NTPase        + More
IPR001650   Helicase_C       
IPR014001   Helicase_ATP-bd       
IPR000629   RNA-helicase_DEAD-box_CS       
IPR014014   RNA_helicase_DEAD_Q_motif       
IPR011545   DEAD/DEAH_box_helicase_dom       
IPR025816   RrmJ-type_MeTrfase       
IPR029063   SAM-dependent_MTases       
IPR002877   rRNA_MeTrfase_FtsJ_dom       
IPR030376   Cap_mRNA_MeTrfase_1       
IPR000467   G_patch_dom       
SUPFAM
SSF52540   SSF52540        + More
SSF53335   SSF53335       
PDB
2I4I     E-value=3.61457e-89,     Score=837

Ontologies

Topology

Length:
415
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.11185
Exp number, first 60 AAs:
0.11185
Total prob of N-in:
0.01042
outside
1  -  415
 
 

Population Genetic Test Statistics

Pi
239.739
Theta
205.824879
Tajima's D
0.518704
CLR
3.8287
CSRT
0.522373881305935
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
28467696 TMGDVTRPETITE 100.00 5e-09
28556443 LIDFLEK 100.00 2e-07
28556443 SLNIFGSSWR 100.00 3e-07
28556443 NLVGVAQTGSGK 100.00 8e-06
28556443 GDGPIALVLAPTR 100.00 1e-04
26822097 TQQERDEVIYQFK 100.00 0.002
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号