SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO06705  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA011754
Annotation
PREDICTED:_ATP-dependent_RNA_helicase_dbp2-like_[Papilio_xuthus]
Location in the cell
Nuclear   Reliability : 3.851
 

Sequence

CDS
ATGCAGTACAACGGGTTTCACAATCAACATCCGATTTTCAGGCCTCAGCCAGACCGCAATGAACAATTCGGTAAAATTCCATACATTAAAGGTCTTCCTGATTTTGGAGGACCTAAAAACTTTGGACCAAGACCTAATATGATGAACAAAAACTTCAGACCTCGAAATGATTTTAATGAAGTAAAGAATGATTATAATACTAAAAATGATGGTAATCAGAATGATTTTGGTGGTCCAAAACAATTTAGACCCAGAAATAATTTTAACAATGGTAACCAACCACCAAAGAAAAACAACTTTAATGGAGACAAATCACCAGGAAATATGCAATATGGCAATAAAAATGATTTTGGCGGTCCTAAACAACAAAATTATAACAAGAATTATGGGCCTAAAACATACAACAACCAGAATTGCTATGGGAATGAGCAGCCTGAATTTATTCCTAGGCAATCTTACAGTCCAAACTCTGTTCAACATTCTTTGAATGATCGCAAACTACAGAGCAAAAAAGCAAAACATCCTGGTGATAGCTTGTTGAAGCCAATGTGGGATCTAACTAAATTAGAACCTATTCAGAAAGACTTTTACAAGCCTCATGTTAATGTAGATGCTCGCTCTGAGGACGATGTGCAAAGATTCCGTGTTACAAAAGAGATTACAGTTAGTGGCAATAATATCCCACGTCCTAACCAATTATTTGAGGAAGGAAACTTCCCCGACCACATTATGAGCACTATTAAGGAACAGCCAAATTTGATAGAGCCCACTGGTATTCAAGCTCAAGGTTGGCCAATAGCTTTATCAGGACGTGACATGGTTGGTATTGCCTCTACTGGTTCAGGAAAAACTTTAGCTTACATGTTGCCTGCGGCTGTGCATATTGTTCATCAACAGCGCATTCAGCGAGGAGATGGGCCAATTGCGCTTATTTTAGCACCTACTCGAGAACTGGCACAGCAAATCCAGTCAGTAGCCCAGGCTTACAGTGCTCGTGGTTGCATAAGAAACACATGCCTTTTTGGAGGTTCACCAAAAGGACCACAAGCCAGAGATTTAGAGCGAGGTGTTGAAATTGTTATTGCCACACCTGGAAGGTTAATTGATTTCCTTGAACGAGGCACTACTAACTTAAGACGCTGCACATATTTAGTTCTGGATGAAGCAGATAGAATGCTTGACATGGGATTTGAACCTCAAATCCGTAAGATAATTGAACAGATTCGCCCTGACCGTCAAGTACTGATGTGGTCTGCCACATGGCCTAAGGAAATACAGGCTTTGGCTGAAGATTTCTTGACCGATTACATCAAAGTTAATATTGGCTCCCTAAACTTGTCTGCCAACAACAACATCAAACAGATTATTGAGATTTGTGAAGAACATGAGAAGGAAGTAAAATTAACTAATTTATTAAAAGAAATTGCTTCTGAAAAAGAAAATAAAGTAATTGTATTTGTAGAGACAAAGAAAAAGGTGGATGATATTGCACGTGCAGTTCGACGCGGTGGATATAAGGCACTTGCTATTCATGGTGACAAATCCCAACCTGAACGTGATGCTGTTCTTACAGAATTCAGAAATGGTTCAACAACCATTCTGATTGCTACTGATGTCGCAGCTCGTGGTCTTGATGTTGAAGATGTCAAATTTGTTGTAAATTTTGACTACCCTAACTCTTCGGAAGACTATATTCATAGAATTGGTCGTACTGGACGGTGCCAACAATCTGGAACTGCATATACATACTTCACGAGTGGTGATTGCCGCCAAGCTCGAGGTCTGCTTGCAGTACTTCGGGAAACTGGACAAAATCCTCCAACTAAATTAGCTGATATGGCTAGAAATAATAACAATAATTCAGGTCGGAATCGCTGGCAACAACGCAAGGATAAAAATAGTGGATCCAACTCACCACAGCAAATGAGCAACCAATGGAACAACAAAATGGCCAATGGCAGCATTGAAGATGGTCAAAACATGTACCAAAATCGTAGCATGAACCAACAGGCACCACGATTTTCTAACCAGAACCAAGGAATTCAGAGTTACAGACAAAACAACTATCAGAAACAAGTACCTTTCCCAAGCCCCAATGTTTTCGAGTCCATGGGAAATTATCAAGGTGGATATAACAATGGTTACCAAAATACTTACAACCAAAATGGATATGGTCAACGGCCCTTCAACAACCAGCGTAATAATGGGCAACAATATCGTAACAATGGTACAAATGGCAACAAAGCCAGTGGCTCTGGTTCTTCATTTGGTTCCCCACCTCCACATTTTGCAACACCTCCTCATTACGCACAGGTGCATCCACATCATCAGGATATGCTTGGTGGAAAATTTTACGGTAGTGGTGTCGGTGGGGGCGGACCCTGTGGATATCAAGCTGCCGTGGGCGCTGGTGTTCCCTACCCGCACTTGCCCCCAGGGCCACTACTATATGCAGCCCCTGTTCAACAGTAA
Protein
MQYNGFHNQHPIFRPQPDRNEQFGKIPYIKGLPDFGGPKNFGPRPNMMNKNFRPRNDFNEVKNDYNTKNDGNQNDFGGPKQFRPRNNFNNGNQPPKKNNFNGDKSPGNMQYGNKNDFGGPKQQNYNKNYGPKTYNNQNCYGNEQPEFIPRQSYSPNSVQHSLNDRKLQSKKAKHPGDSLLKPMWDLTKLEPIQKDFYKPHVNVDARSEDDVQRFRVTKEITVSGNNIPRPNQLFEEGNFPDHIMSTIKEQPNLIEPTGIQAQGWPIALSGRDMVGIASTGSGKTLAYMLPAAVHIVHQQRIQRGDGPIALILAPTRELAQQIQSVAQAYSARGCIRNTCLFGGSPKGPQARDLERGVEIVIATPGRLIDFLERGTTNLRRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQVLMWSATWPKEIQALAEDFLTDYIKVNIGSLNLSANNNIKQIIEICEEHEKEVKLTNLLKEIASEKENKVIVFVETKKKVDDIARAVRRGGYKALAIHGDKSQPERDAVLTEFRNGSTTILIATDVAARGLDVEDVKFVVNFDYPNSSEDYIHRIGRTGRCQQSGTAYTYFTSGDCRQARGLLAVLRETGQNPPTKLADMARNNNNNSGRNRWQQRKDKNSGSNSPQQMSNQWNNKMANGSIEDGQNMYQNRSMNQQAPRFSNQNQGIQSYRQNNYQKQVPFPSPNVFESMGNYQGGYNNGYQNTYNQNGYGQRPFNNQRNNGQQYRNNGTNGNKASGSGSSFGSPPPHFATPPHYAQVHPHHQDMLGGKFYGSGVGGGGPCGYQAAVGAGVPYPHLPPGPLLYAAPVQQ

Summary

Similarity
Belongs to the DEAD box helicase family.
Pfam
PF00271   Helicase_C        + More
PF00270   DEAD
Interpro
IPR014014   RNA_helicase_DEAD_Q_motif        + More
IPR011545   DEAD/DEAH_box_helicase_dom       
IPR001650   Helicase_C       
IPR014001   Helicase_ATP-bd       
IPR000629   RNA-helicase_DEAD-box_CS       
IPR027417   P-loop_NTPase       
SUPFAM
SSF52540   SSF52540       
PDB
4A4D     E-value=1.957e-97,     Score=911

Ontologies

Topology

Length:
823
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.01516
Exp number, first 60 AAs:
0
Total prob of N-in:
0.00042
outside
1  -  823
 
 

Population Genetic Test Statistics

Pi
27.319142
Theta
146.108453
Tajima's D
-2.092154
CLR
4320.663781
CSRT
0.00974951252437378
Interpretation
Possibly Positive selection

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
26822097 QVIMWSATWPK 100.00 4e-07
26280517 CQEIHDWFDSVIK 100.00 4e-07
28467696 CQITGMHGCMFIDK 100.00 4e-07
26822097 EQPNIIEPTGIQAQGWPIAISGR 100.00 1e-06
28467696 TYNNECIIDCATR 100.00 1e-06
26822097 TYNNQNCYGNEQPEFIPR 100.00 1e-05
28556443 GDGPIALILAPTR 100.00 1e-05
26280517 MAMEVINIQQKPAK 100.00 2e-04
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号