SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO06704
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.867
 

Sequence

CDS
ATGACCGTCCAAGTACAGAAAGACCAGACGAGATCAATCCAGTTGCGCAGAGGTATAAGACAGGGGGATATTATATCCCCGAAACTATTTACAAGCGCACTGGAGGACGTCTTCAAGACTCTCGACTGGAACGGACGCGGCATTAACATAAACGGCGAGTACATTTCACATCTTCGCTTTGCCGATGACATCGTCATCATGGCGGTATCGCTGCAGGACCTACAAGAAAAGCTGTACAGCCTTAATACTGCATCTCAACGGGTAGATAAGACCAAGATAATATTTAACGGAAACGTCATTCCGAGACCAATCGATGTTGATGGTACACCTGAGGAAGTGTATGTCTACCTGGCAGAGACCCTACAACTAGGTAGAAATAATTTTGAGAAGGAAGTGATCAGAAGGATTCAGTTGGGCTGGGCAGCATTTGGGAAGCTTCGTCAGGTCTTTTCGTCACCCATACCACAATGTCTGAAGACAAATGTCTATAATCAGTGCGTCCTACCCGTGCTTACCTACGGAGCCGAAACGTGGACGCTGACCGTGCGACTAGTCTATCAACCAAAAATTACTCAGCGAGCTATAGAGCGAGCTATGCTTGGTTTATCATTGCGAGACCGAATACGTAATGAAGTTATTCGGGCAAAAACCAAGGTGATCGATATAGCTTGCAGAGTTAGTAAGCTGAAGTGGCAGTGGGCCGGTCACATATGTCGCAGAACCGATAACCTTTGGGGTAGACGTATTCTGGAGTGGAGACCGCGAACCGGCAAACGGAGTGTAGGACATCCTCCTGCTATTTGGAGCGACGATATGCGCAAGGCAGCTGGCAGTAACTGGTTGCATAGAACCGAAGATCGGGTTCAGTGGCGAGCTTTGGGGGAGGCCTATGTCCAGCAGTGGACTGCCACAGGCTGA
Protein
MTVQVQKDQTRSIQLRRGIRQGDIISPKLFTSALEDVFKTLDWNGRGININGEYISHLRFADDIVIMAVSLQDLQEKLYSLNTASQRVDKTKIIFNGNVIPRPIDVDGTPEEVYVYLAETLQLGRNNFEKEVIRRIQLGWAAFGKLRQVFSSPIPQCLKTNVYNQCVLPVLTYGAETWTLTVRLVYQPKITQRAIERAMLGLSLRDRIRNEVIRAKTKVIDIACRVSKLKWQWAGHICRRTDNLWGRRILEWRPRTGKRSVGHPPAIWSDDMRKAAGSNWLHRTEDRVQWRALGEAYVQQWTATG

Summary

Similarity
Belongs to the ATP-dependent DNA ligase family.
EMBL
FJ265542    ADI61810.1    FJ265550    ADI61818.1    FJ265551    ADI61819.1    + More
EF113399    EF113400    ABO45233.1    EF113398    EF113401    ABO45231.1    EF113402    ABO45239.1    FJ265549    ADI61817.1    RSAL01002362    RVE40503.1    RSAL01002130    RVE40575.1    FJ265545    ADI61813.1    FJ265544    ADI61812.1    FJ265543    ADI61811.1    KZ150072    PZC74016.1    RSAL01000007    RVE54059.1    KZ149985    PZC75698.1    AAGJ04144474    RSAL01000016    RVE53061.1    MRZV01002136    PIK34564.1    GFAC01005640    JAT93548.1    MRZV01000899    PIK42833.1    GBBI01004876    JAC13836.1    MRZV01000640    PIK46507.1    KZ150317    PZC71439.1    KZ150485    PZC70710.1    AAGJ04050748    FJ265562    ADI61830.1    FJ265561    ADI61829.1    ODYU01004982    SOQ45402.1    JARK01001396    EYC09581.1    FJ265564    ADI61832.1    KZ149912    PZC78089.1    KZ150108    PZC73382.1    FJ265563    ADI61831.1    JARK01001434    EYC02684.1    JARK01000347    EYC38051.1    KZ149907    PZC78256.1    JARK01001621    EYB86109.1    JARK01000460    EYC36749.1    GBGD01000453    JAC88436.1    JARK01001655    EYB84321.1    GBBI01004877    JAC13835.1    JARK01001626    EYB85833.1    JARK01001340    EYC30828.1    JARK01000807    EYC34984.1    GFTR01005437    JAW10989.1    GDKW01001596    JAI54999.1    JARK01001351    EYC23394.1    JARK01001736    JARK01001462    JARK01001379    JARK01001338    EYB80775.1    EYB98943.1    EYC13646.1    EYC33347.1    JARK01001370    EYC16151.1    JARK01001677    EYB83168.1    EYB83167.1    EYC23395.1    EYC31295.1    GBBM01001358    JAC34060.1    JARK01001362    EYC18844.1    JARK01000173    EYC41342.1    EYC18843.1    JARK01001512    EYB94036.1    JARK01000388    EYC37469.1    EYC16150.1    GEDV01010296    JAP78261.1    JARK01001639    EYB85201.1    JARK01001389    EYC11015.1    JARK01000224    EYC40226.1    JARK01001372    EYC15539.1    JARK01001608    EYB86877.1    JARK01001414    JARK01001412    EYC06128.1    EYC06440.1    JARK01000189    EYC40935.1    JARK01000449    EYC36872.1    ODYU01004088    SOQ43598.1    GBGD01000380    JAC88509.1    JARK01000384    EYC37506.1    JARK01001364    EYC18031.1    JARK01001423    EYC04578.1    JARK01001348    EYC25257.1    EYC37503.1    EYC37504.1    EYC37505.1    JARK01001349    EYC24735.1    JARK01001346    EYC26784.1    JARK01001344    EYC28218.1    JARK01001361    EYC19034.1    JARK01001341    EYC30223.1    JARK01001343    EYC28635.1    JARK01001517    EYB93530.1    JARK01001367    EYC17351.1    EYC31302.1    JARK01001378    EYC13977.1    JARK01001406    EYC07496.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF01826   TIL
PF11411   DNA_ligase_IV
PF04675   DNA_ligase_A_N
PF04679   DNA_ligase_A_C
PF01068   DNA_ligase_A_M
PF13855   LRR_8
Interpro
IPR005135   Endo/exonuclease/phosphatase        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR000477   RT_dom       
IPR036084   Ser_inhib-like_sf       
IPR002919   TIL_dom       
IPR001357   BRCT_dom       
IPR036420   BRCT_dom_sf       
IPR012340   NA-bd_OB-fold       
IPR016059   DNA_ligase_ATP-dep_CS       
IPR012310   DNA_ligase_ATP-dep_cent       
IPR021536   DNA_ligase_IV_dom       
IPR029710   LIG4       
IPR000977   DNA_ligase_ATP-dep       
IPR012308   DNA_ligase_ATP-dep_N       
IPR036599   DNA_ligase_N_sf       
IPR012309   DNA_ligase_ATP-dep_C       
IPR032675   LRR_dom_sf       
IPR001611   Leu-rich_rpt       
IPR003591   Leu-rich_rpt_typical-subtyp       
SUPFAM
SSF56219   SSF56219        + More
SSF57567   SSF57567       
SSF52113   SSF52113       
SSF50249   SSF50249       

Ontologies

Topology

Length:
305
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.06876
Exp number, first 60 AAs:
0.00126
Total prob of N-in:
0.14609
outside
1  -  305
 
 

Population Genetic Test Statistics

Pi
247.368203
Theta
199.270558
Tajima's D
0.759736
CLR
28.736285
CSRT
0.585220738963052
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号