SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO06466
Annotation
AF461149_1_transposase_[Bombyx_mori]
Location in the cell
Cytoplasmic   Reliability : 1.401 Extracellular   Reliability : 1.187
 

Sequence

CDS
ATGGTATGGTTGGGAGTTTCTTATTGGGGCTTAGCAGAGGTACATTTTTGTGAGAAAGGTGTAAAAACGAATGCAGTTGTGTATCAAAATACAGTCCTGACGAACCTTGTGGAACCTGTTTCTCATACCATGTTCAATAACAGGCACTGGGTATTCCAACAAGATTCGGTGCCAGCTCATAGAGCGAAGAGCACACAAGACTGGCTGGCGGCGCGTGAAATCGACTTCATCCGGCACGAAGACTGGCCCTCCTCCAGTCCAGATTTGAATCCGTTAGATTACAAGATATGGCAACACTTGGAGGAAAAGGCGTGCTCAAAGCCTCATCCCAATTTGGAGTCACTCAAGACATCCTTGATTAAGGCAGCCGCCGATATTGACACGGACCTCGTTCGTGCTGCGATAGACGACTGGCCGCGCAGATTGAAGGCCTGTATTTAA
Protein
MVWLGVSYWGLAEVHFCEKGVKTNAVVYQNTVLTNLVEPVSHTMFNNRHWVFQQDSVPAHRAKSTQDWLAAREIDFIRHEDWPSSSPDLNPLDYKIWQHLEEKACSKPHPNLESLKTSLIKAAADIDTDLVRAAIDDWPRRLKACI

Summary

Similarity
Belongs to the TGF-beta family.
EMBL
AF461149    AAN06610.1    AB363028    BAG15927.1    AB363006    AB363010    + More
AB363014    BAG15923.1    BAG15924.1    AB473770    BAH20555.1    AB363018    BAG15926.1    RSAL01000114    RVE46946.1    RSAL01000012    RVE53510.1    RSAL01000174    RVE45058.1    KQ459680    KPJ20472.1    U47917    AAB47739.1    JF779677    AEO90418.1    RSAL01000200    RVE44486.1    RSAL01000209    RVE44259.1    RSAL01000387    RVE42024.1    RSAL01000004    RVE54604.1    RSAL01000470    RVE41612.1    LNIX01000030    OXA41211.1    JARK01001411    EYC06502.1    UZAH01000669    VDO19161.1    PDUG01000005    PIC23776.1    DS268420    EFO87874.1    UYSL01019905    VDL71189.1    DS268433    EFO97645.1    UZAH01026445    VDO80847.1    DS268747    EFP00909.1    JOJR01000583    RCN36166.1    KN728435    KIH63782.1    PDUG01000012    PIC13506.1    JOJR01000015    RCN51257.1    CAVP010058755    CDL95145.1    UZAH01031030    VDP13493.1    JARK01001601    EYB87313.1    DS268612    EFO94085.1    UYSL01022144    VDL79905.1    DS268492    EFP11674.1    UYSL01009772    VDL68385.1    DS268539    EFO88027.1    UZAH01025744    VDO69727.1    UZAH01001595    VDO19836.1    EFP11689.1    DS268428    EFO94379.1    DS268606    EFO93488.1    HE601413    CAS00486.1    DS268466    EFP06959.1    DS268508    EFO83264.1    JARK01001345    EYC27589.1    CAVP010059404    CDL95787.1    PIC29926.1    DS268679    EFO98285.1    DS268525    EFO85497.1    JARK01001418    EYC05389.1    DS268565    EFO90304.1    JARK01001658    EYB84158.1    PDUG01000001    PIC51673.1    DS268421    EFO88618.1    PDUG01000006    PIC20538.1    DS268673    EFO98001.1    JARK01001337    EYC34439.1    JARK01000059    EYC44525.1    UYSL01021399    VDL78127.1    PIC28734.1    DS268545    EFO88382.1    UYSL01002425    VDL65835.1    JARK01000176    EYC41234.1    PIC31069.1    UYSL01020634    VDL75527.1    CAVP010058332    CDL94449.1    PIC53815.1    PDUG01000004    PIC32571.1    KN769991    KIH46151.1    HE601190    CAP37344.1   
Pfam
PF00431   CUB        + More
PF00019   TGF_beta
PF13358   DDE_3
PF00722   Glyco_hydro_16
PF00292   PAX
Interpro
IPR009057   Homeobox-like_sf        + More
IPR000859   CUB_dom       
IPR035914   Sperma_CUB_dom_sf       
IPR001839   TGF-b_C       
IPR029034   Cystine-knot_cytokine       
IPR017948   TGFb_CS       
IPR015615   TGF-beta-rel       
IPR038717   Tc1-like_DDE_dom       
IPR000757   GH16       
IPR013320   ConA-like_dom_sf       
IPR001523   Paired_dom       
IPR036388   WH-like_DNA-bd_sf       
SUPFAM
SSF46689   SSF46689        + More
SSF49854   SSF49854       
SSF57501   SSF57501       
SSF49899   SSF49899       
Gene 3D
PDB
5CR4     E-value=1.06212e-08,     Score=137

Ontologies

Topology

Subcellular location
Secreted  
Length:
146
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00722
Exp number, first 60 AAs:
0.00722
Total prob of N-in:
0.07692
outside
1  -  146
 
 

Population Genetic Test Statistics

Pi
8.383568
Theta
17.624708
Tajima's D
-1.587024
CLR
0.122365
CSRT
0.0500974951252437
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号