SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO06426  Validated by peptides from experiments
Annotation
PREDICTED:_alanine--glyoxylate_aminotransferase_2?_mitochondrial_[Amyelois_transitella]
Location in the cell
Cytoplasmic   Reliability : 1.582 Mitochondrial   Reliability : 1.186
 

Sequence

CDS
ATGATGGCATTGACTGCAATGCAAAGCTTCAGGCAACCAATACCAGTTCCCCCTGGATTTCATCACGCCATGGTTCCAGATCCATTTAGAAATGAATGGGGTGGATGTCGGGATTGCATTTCTCAAGTGCCAGACTCGTGCTCCTGTACGGGAGATTGTCTTTCTACTGATAAATATATCGATCAATTGAAAGAGGTTCTTGAGTTTTCGATACCTAGTCGACGGGTAGCGGCGTTCTTTGCTGAGTCTATCCAGGGGGCTGGAGGGATCGTGCAGTTCCCAAAGGGTTACATTAAGAGAGCTCAACAGCTTATTAAAGAGCATGGTGGCATATTTGTTGCTGACGAGGTCCAGACTGGTTTTGCGCGTACTGGTGACACTTTCTGGGGTTTCGAATCACACGGTATCATTCCTGACATAGTAACGCTGGCGAAAGGCATCGCTAACGGGTTGCCGTTTGCAGCTGTAGTTACGACCAAAGAAATCGCCGAGGCACATACTAAAGCGAATTACTTTAACACTTTTAGTGGCAATGCTCTGGCGGCAGCAGCTGGCGTGGCTGTATTGGAGGTGATTGACGATGAAAACATTCAAGATCATTGCAAGAAGATAGGAGAATATTTTATTCGTCAATTAATACAGCTTCAACAACAATTTCCGATTATTGGTGACGTCAGGGGTAAAGGTCTGATGTTGGCAATGGAACTAGTTAGACCAGGCACTAAAGAAAATTTGAGTGACAATTGCATGATAAGAATGCATCAAAGATTAAAAGATCTTGGCGTTTTGACTGGTCTTGGTGGTCGGAACCTAAATGTCTTGAAAATAACTCCACCGATGTGTATTACTAAAGAAGACGTGGATTTTGCAGTATCCGTTTTTAATGATGTTTTTAAGCAATTCTCTTAA
Protein
MMALTAMQSFRQPIPVPPGFHHAMVPDPFRNEWGGCRDCISQVPDSCSCTGDCLSTDKYIDQLKEVLEFSIPSRRVAAFFAESIQGAGGIVQFPKGYIKRAQQLIKEHGGIFVADEVQTGFARTGDTFWGFESHGIIPDIVTLAKGIANGLPFAAVVTTKEIAEAHTKANYFNTFSGNALAAAAGVAVLEVIDDENIQDHCKKIGEYFIRQLIQLQQQFPIIGDVRGKGLMLAMELVRPGTKENLSDNCMIRMHQRLKDLGVLTGLGGRNLNVLKITPPMCITKEDVDFAVSVFNDVFKQFS

Summary

Similarity
Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family.
EMBL
BABH01012406    AGBW02008141    OWR54114.1    KQ460971    KPJ10138.1    KZ149896    + More
PZC78740.1    RSAL01000104    RVE47398.1    KQ459590    KPI97174.1    KPJ10139.1    ODYU01002894    SOQ40953.1    BABH01012403    BABH01012404    BABH01012405    LNIX01000014    OXA47066.1    GANO01003035    JAB56836.1    GFDL01007485    JAV27560.1    CH477198    EAT48281.1    ACPB03014069    GAMD01000541    JAB01050.1    KK854169    PTY12508.1    GBBI01002763    JAC15949.1    GFTR01006539    JAW09887.1    GDKW01002596    JAI53999.1    KQ429994    KOF64825.1    BDGG01000008    GAV02097.1    GEZM01087795    JAV58472.1    GFDL01007644    JAV27401.1    GGFJ01004628    MBW53769.1    GGFJ01004627    MBW53768.1    GBRD01001221    GDHC01020519    GDHC01008915    JAG64600.1    JAP98109.1    JAQ09714.1    HACA01006865    CDW24226.1    AAAB01008986    EAL38668.3    APCN01003309    KA644689    AFP59318.1    KA649211    AFP63840.1    GFDL01007704    JAV27341.1    GDHF01030340    JAI21974.1    GDHF01000762    JAI51552.1    GECZ01006386    JAS63383.1    GEBQ01028908    JAT11069.1    DS232318    EDS39923.1    DS231920    EDS26402.1    ATLV01023952    KE525347    KFB50166.1    MNPL01004920    OQR76350.1    AXCN02001025    GGFL01006255    MBW70433.1    EAT48282.1    GBBM01000938    JAC34480.1    GFAC01001256    JAT97932.1    GBXI01011266    JAD03026.1    NEDP02003738    OWF48054.1    GGFK01010341    MBW43662.1    GBXI01014362    JAC99929.1    JH815890    EKC31351.1    NEVH01013243    PNF29508.1    CVRI01000047    CRK97743.1    JRES01000763    KNC28486.1    ADMH02001279    ETN63238.1    UFQT01000127    SSX20548.1    CM000159    KRK02512.1    GEBQ01020729    GEBQ01007951    JAT19248.1    JAT32026.1    SSX20547.1    GBXI01017014    JAC97277.1    CH964101    EDW79599.1    GACK01004887    JAA60147.1    CH954178    EDV52788.2    GEFM01004970    JAP70826.1    SSX20546.1    AE014296    BT030854    AAN12201.2    ABV82236.1    ALI30495.1    GAMC01021467    GAMC01021466    GAMC01021465    GAMC01021464    JAB85089.1    GANP01010403    JAB74065.1    BT044304    AAF51855.3    ACH92369.1    AY058552    AAL13781.1    SSX20545.1    HACG01030985    CEK77850.1    GFWV01012742    MAA37471.1    GL732541    EFX81878.1    GFPF01005854    MAA17000.1    EDW95556.2    GEDV01001983    JAP86574.1    CAEY01000384    CH902618    EDV41383.2    JO842256    AEO33873.1    JH431841    CH379070    EAL29896.2    AFYH01129082    AFYH01129083    AFYH01129084    AFYH01129085    AFYH01129086    AFYH01129087    AFYH01129088    AFYH01129089    CH940647    EDW70025.2    GBYB01007080    JAG76847.1    CM002912    KMZ01222.1   
Pfam
PF00202   Aminotran_3        + More
PF07973   tRNA_SAD
Interpro
IPR015422   PyrdxlP-dep_Trfase_dom1        + More
IPR005814   Aminotrans_3       
IPR015424   PyrdxlP-dep_Trfase       
IPR015421   PyrdxlP-dep_Trfase_major       
IPR009000   Transl_B-barrel_sf       
IPR018163   Thr/Ala-tRNA-synth_IIc_edit       
IPR012947   tRNA_SAD       
IPR018165   Ala-tRNA-synth_IIc_core       
SUPFAM
SSF53383   SSF53383        + More
SSF55186   SSF55186       
SSF50447   SSF50447       
Gene 3D
PDB
3N5M     E-value=3.63634e-31,     Score=335

Ontologies

Topology

Length:
302
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.23018
Exp number, first 60 AAs:
0
Total prob of N-in:
0.01979
outside
1  -  302
 
 

Population Genetic Test Statistics

Pi
251.00807
Theta
185.100004
Tajima's D
1.190988
CLR
0
CSRT
0.713714314284286
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
26822097 DCISQVPDSCSCTGDCISTDKYIDQIK 95.24 2e-09
26822097 VAAFFAESIQGAGGIVQFPK 95.45 4e-09
26822097 ITPPMCITK 100.00 1e-06
26822097 IKDIGVITGIGGR 100.00 2e-05
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号