SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO06415
Annotation
Retrovirus-related_Pol_polyprotein_from_transposon_17.6_[Operophtera_brumata]
Location in the cell
Nuclear   Reliability : 1.825
 

Sequence

CDS
ATGCCGCCGCGAAAAATACGCCAACAGACGGATGACAATAGTGATTCTGGTGATGAAAAGGTGGACGCAGTGCCCTCGCCAGCACCAGTGCTCATGTCCGGGGATCAGCTGTCCTCGCTCCTGGCCGCCTTCTCAAAGTCGCAGGCCGAGGCGAACCGACAACTCGTCGAGTCCCTGTGGGCATCGCATGGTTTGGGAAGTGGATCGAAGTTCACCACCCCGATAGTGTCACCGCCCCCGACGCCAACAAGTAACATGGCTAAATGCACCGCGCGTTTTGATGGCGTCACTCGCGATCCGGAGGCCGTTGAAGCGTTTATCGACTCTGTGGAGGTGTACAAGGAGTGTGCGTGCGTCTCTGACGATATCGCATTGCGTGGACTGCCAATGCTCATGGAAGGCGAAGCAGCCATATGGTGGAGAGGGGTCCGGAATGAAGTGTCCTCGTGGCCCGACGCTCTCAAAAGGTTACGAGCTATGTATGGTGTGCCACGCCCTGCACATAAAGTTTTTCGTGACGTGTTTTCGTCTGAGCAAGGTGATGAGCTTGCTGACAGTTTCATAGTGAGGATACGTGCTATGCTGTCCAGATTGCCGTACCAGCTACCAGAGGAAGCCAGGTTAGACATAATCTACGGTCTACTTCATAAACGGATAAGGAAAAGACTACCGAGAGATGGTGTGAGCGACATAGAAACACTCATAGAGAAGTCGCGCATGGTGGAGGAGTCACTTGTGGAGTGCACGGCTGCCCTCAACATTCCGCCGCAGCCACACAAGTCGTTACCTACGGTGTTCGGCGAACGCAGCTCCGCGCCTGACGTGACAAGTGTGAGATCGCCGAGACCTGCCGGCGCTGCCGCTGCGCTAGTGCGCGCCTCCGTTGCTGTTGCACCGTCGTCGCTACCTCAACCGTCCCCATCCCCGCGTAGTATGAAAAGCGAAACATTGTGA
Protein
MPPRKIRQQTDDNSDSGDEKVDAVPSPAPVLMSGDQLSSLLAAFSKSQAEANRQLVESLWASHGLGSGSKFTTPIVSPPPTPTSNMAKCTARFDGVTRDPEAVEAFIDSVEVYKECACVSDDIALRGLPMLMEGEAAIWWRGVRNEVSSWPDALKRLRAMYGVPRPAHKVFRDVFSSEQGDELADSFIVRIRAMLSRLPYQLPEEARLDIIYGLLHKRIRKRLPRDGVSDIETLIEKSRMVEESLVECTAALNIPPQPHKSLPTVFGERSSAPDVTSVRSPRPAGAAAALVRASVAVAPSSLPQPSPSPRSMKSETL

Summary

Pfam
PF00077   RVP        + More
PF00665   rve
PF17921   Integrase_H2C2
PF00078   RVT_1
Interpro
IPR001878   Znf_CCHC        + More
IPR001969   Aspartic_peptidase_AS       
IPR018061   Retropepsins       
IPR021109   Peptidase_aspartic_dom_sf       
IPR036397   RNaseH_sf       
IPR041588   Integrase_H2C2       
IPR001584   Integrase_cat-core       
IPR012337   RNaseH-like_sf       
IPR036875   Znf_CCHC_sf       
IPR000477   RT_dom       
SUPFAM
SSF50630   SSF50630        + More
SSF53098   SSF53098       
SSF57756   SSF57756       
Gene 3D

Ontologies

Topology

Length:
317
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00597
Exp number, first 60 AAs:
0.0006
Total prob of N-in:
0.08300
outside
1  -  317
 
 

Population Genetic Test Statistics

Pi
417.183935
Theta
223.84023
Tajima's D
2.71996
CLR
0
CSRT
0.96275186240688
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号