Gene

KWMTBOMO06268  Validated by peptides from experiments

Pre Gene Modal

BGIBMGA001818

Annotation

PREDICTED:_nuclear_pore_complex_protein_Nup98-Nup96_isoform_X1_[Bombyx_mori]

Location

Bomo_Chr11(+):3577596-3583811      View in EpiBrowser

Full name

Nuclear pore complex protein Nup98-Nup96      

Location in the cell

Cytoplasmic   Reliability : 1.21 Nuclear   Reliability : 1.371

CDS

ATGAGACCGCCCCTGCCGGATTACAATGAAGATTACTGCTACATCACGAGTAAGAATGGAAATACGAAAGCGGTGTTGGATTTACGCTACGAGCTTATTAGAGCAAGAGCTTTCAATCAACGTCCGAAACTTAAGCCCGCAGCTTACACTCCGGATCCGAACGATTTTACACTGTGCTTCCTCCTGGGCGCGTGGTTCGGCAGTCCGTCGGTGGAGAGCGTGGTGTCGGTGGCGGAGCAGCTGGAGGCGGGCGGCGCGTGGCAGCTGGCCACCGCCGTGCTGGCGTACCATCCGCACGGAGCCGCCCGATCCTCGCTGGTGAGGAGCATGATCTCGCGGCACGCGCCGTCCTCGGGCTCCGCCCCCGGCCTCCAGCTGCTGGAGCGGATCGGGGTGCCCGAGAAGTGGATCCACCTGGCTCGCGCGCACAGGGCCAAGTACGAGCACCAGCCGGCGCTGGAGGTGGAGCATCTGTTGGCAGCGCGGCAGTGGAGCGCCGCGCACCGCGTGCTGCTGGACGAGCTGCTTCCCGACGCCGTGCTCAACGACGATCTGCAAACTGTATCCCGGCTGCTGAAGACGCTGGAGGAGGCGGCCGAGCGACACGAGGTGGCCGACTGGGAGAGCGGCGGGCTCGCGCTGTCCCACTACATACACGTCTGTGACGAGATAATGGCGATACAGAATGAAGGCGATCAGTGGGGACGGCTGGAGGCGCTTCGCCCCCGCCTGGCCGCCGCCTGTAGGGCGCTGCCCCCTCCACAACACATGTCGCCGCGTGTGGCCGCGGCCCGAGCGCAGATGGGGGGTCGCTTGCTGCGGCTGACGCTGTCCGCCAACCTGTCCGCCGACAAGCTGGCGTCGCTGGTGGCCGCCCTGAAGCTGCCCCCGGACTGCTCCGCCTGCGCCAGTCACAAGATAACAACAGAACTCGCCGAACGCAGATTAGAAGGGAATTATACGGCCCTGCTTGCACCTTAA

Protein

MRPPLPDYNEDYCYITSKNGNTKAVLDLRYELIRARAFNQRPKLKPAAYTPDPNDFTLCFLLGAWFGSPSVESVVSVAEQLEAGGAWQLATAVLAYHPHGAARSSLVRSMISRHAPSSGSAPGLQLLERIGVPEKWIHLARAHRAKYEHQPALEVEHLLAARQWSAAHRVLLDELLPDAVLNDDLQTVSRLLKTLEEAAERHEVADWESGGLALSHYIHVCDEIMAIQNEGDQWGRLEALRPRLAAACRALPPPQHMSPRVAAARAQMGGRLLRLTLSANLSADKLASLVAALKLPPDCSACASHKITTELAERRLEGNYTALLAP

Description

Plays a role in the nuclear pore complex (NPC) assembly and/or maintenance. NUP98 and NUP96 are involved in the bidirectional transport across the NPC. May anchor NUP153 and TPR to the NPC. In cooperation with DHX9, plays a role in transcription and alternative splicing activation of a subset of genes (PubMed:28221134). Involved in the localization of DHX9 in discrete intranuclear foci (GLFG-body) (PubMed:28221134).
Plays a role in the nuclear pore complex (NPC) assembly and/or maintenance. Involved in the bidirectional transport across the NPC. May anchor NUP153 and TPR to the NPC.
Plays a role in the nuclear pore complex (NPC) assembly and/or maintenance. NUP98 and NUP96 are involved in the bidirectional transport across the NPC. May anchor NUP153 and TPR to the NPC. In cooperation with DHX9, plays a role in transcription and alternative splicing activation of a subset of genes. Involved in the localization of DHX9 in discrete intranuclear foci (GLFG-body).

Subunit

Part of the nuclear pore complex (NPC) (PubMed:15229283, PubMed:18287282). Interacts directly with NUP96 (PubMed:12191480). Part of the Nup160 subcomplex in the nuclear pore which is composed of NUP160, NUP133, NUP107 and NUP96; this complex plays a role in RNA export and in tethering NUP98 and NUP153 to the nucleus (PubMed:11684705). Interacts with RAE1 (PubMed:10209021, PubMed:20498086). Does not interact with TPR (PubMed:11684705). Interacts directly with NUP88 and NUP214, subunits of the cytoplasmic filaments of the NPC (By similarity). Interacts (via N-terminus) with DHX9 (via DRBM, OB-fold and RGG domains); this interaction occurs in a RNA-dependent manner and stimulates DHX9-mediated ATPase activity (PubMed:28221134).
(Microbial infection) Interacts with vesicular stomatitis virus protein M (PubMed:11106761).
Part of the nuclear pore complex (NPC). Interacts directly with NUP96. Part of the Nup160 subcomplex in the nuclear pore which is composed of NUP160, NUP133, NUP107 and NUP96; this complex plays a role in RNA export and in tethering NUP98 and NUP153 to the nucleus. Interacts with RAE1. Does not interact with TPR. Interacts directly with NUP88 and NUP214, subunits of the cytoplasmic filaments of the NPC. Interacts (via N-terminus) with DHX9 (via DRBM, OB-fold and RGG domains); this interaction occurs in a RNA-dependent manner and stimulates DHX9-mediated ATPase activity.

Similarity

Belongs to the nucleoporin GLFG family.

Keywords

3D-structure   Acetylation   Alternative splicing   Autocatalytic cleavage   Chromosomal rearrangement   Complete proteome   Direct protein sequencing   Host-virus interaction   Hydrolase   Isopeptide bond   Membrane   mRNA transport   Nuclear pore complex   Nucleus   Phosphoprotein   Polymorphism   Protease   Protein transport   Reference proteome   Repeat   Serine protease   Translocation   Transport   Ubl conjugation  

Feature

chain  Nuclear pore complex protein Nup98
splice variant  In isoform 2, isoform 4 and isoform 5.
sequence variant  In a breast cancer sample; somatic mutation.

Uniprot

H9IX35   A0A194Q4W3   A0A2W1BLS0   A0A212F926   A0A2M4A068   A0A2M3ZZQ1   + More
A0A182FR72   A0A1B0B8F3   A0A034V6D0   A0A1A9Y2K9   A0A336LFV7   T1EAL4   A0A2M3ZZY1   A0A091G603   A0A2L2Y5W2   A0A336KXZ5   A0A2M4B8W5   A0A093HLV1   A0A182VQ92   A0A1A9WVG8   T1IPI4   A0A182RCW1   A0A093BPU1   A0A0K8U4G4   A0A1A9VGF5   A0A1A9ZUP2   W5JD26   A0A0K8WGH0   A0A1B0FAH0   A0A0A1WUD9   A0A0A1WPK7   K9IPD0   K9J3Z7   A0A093IB35   A0A093F2W3   A0A2Y9SDG7   A0A2Y9MHS6   A0A2Y9SEW8   A0A2Y9MKI0   A0A2Y9MKI4   A0A2Y9MH87   A0A2Y9S6R3   A0A340XVD3   Q7QBX5   A0A341AEL1   A0A341AA59   A0A182XID2   G3SH93   A0A099Z778   U3K6I4   A0A182VF73   W5NVX9   W5NVY1   G1LWU9   E1BCV4   D2HYT4   A0A087VHJ3   L8J2T2   A0A182MCY3   A0A182K2G3   A0A1S3F062   A0A182Y7A1   A0A1S3F055   H0V7X8   A0A2M3ZFG0   A0A3Q7Y6Z4   P52948-6   A0A384DEQ7   A0A3Q7Y108   A0A3Q7WLC0   A0A3Q7Y6Z8   A0A384DER3   A0A384DF97   P52948   P52948-5   A0A3L8RTL3   A0A212DJ24   A0A218UH21   A0A091KE74   A0A087QNE8   A0A182PA24   H2NEI3   A0A2J8V286   I7G613   A0A0L0CEF9   L9LAX6   H9H2Z0   H7C3P6   P49793   A0A093T8F8   A0A2J8IU24   A0A3Q7TM51   A0A3Q7TYV9   F6R2Q1  

EC Number

3.4.21.-

Pubmed

19121390    26354079    28756777    22118469    25348373    26561354    + More
20920257    23761445    25830018    12364791    14747013    17210077    22398555    20809919    20010809    19393038    22751099    25244985    21993624    8563754    10087256    16554811    15489334    17974005    10556215    10209021    11106761    11493482    11684705    11986249    11839768    12802065    15229283    16028218    15725483    17081983    16467868    16964243    17287853    18220336    18691976    18669648    18318008    19413330    19690332    19608861    20407419    20068231    21269460    21406692    22058212    23186163    24275569    25944712    28221134    28112733    12191480    18287282    20498086    16959974    24813606    30282656    29294181    17194215    26108605    23385571    17431167    7736573    22673903    18464734   

EMBL

BABH01021286    KQ459463    KPJ00394.1    KZ150084    PZC73806.1    AGBW02009652    + More
OWR50231.1    GGFK01000717    MBW34038.1    GGFK01000706    MBW34027.1    JXJN01009920    GAKP01021834    JAC37118.1    UFQS01003267    UFQT01003267    SSX15435.1    SSX34804.1    GAMD01000933    JAB00658.1    GGFK01000744    MBW34065.1    KL447080    KFO69642.1    IAAA01009455    IAAA01009456    IAAA01009457    LAA02700.1    UFQS01001329    UFQT01001329    SSX10382.1    SSX30070.1    GGFJ01000127    MBW49268.1    KL206203    KFV79957.1    JH431263    KL451229    KFV05760.1    GDHF01030923    JAI21391.1    ADMH02001587    ETN61956.1    GDHF01002112    JAI50202.1    CCAG010015281    GBXI01012157    JAD02135.1    GBXI01013969    JAD00323.1    GABZ01003500    JAA50025.1    GABZ01003506    JAA50019.1    KK590751    KFV99924.1    KK620339    KFV50835.1    AAAB01008859    EAA08227.5    CABD030077206    CABD030077207    CABD030077208    CABD030077209    KL891034    KGL78314.1    AGTO01012089    AMGL01032342    ACTA01002145    ACTA01010145    ACTA01018145    ACTA01026145    ACTA01034145    ACTA01042144    ACTA01050144    ACTA01178136    ACTA01186134    ACTA01194132    GL193731    EFB29397.1    KL493705    KFO12085.1    JH880247    ELR63046.1    AXCM01001786    AAKN02051231    AAKN02051232    AAKN02051233    GGFM01006545    MBW27296.1    U41815    AB040538    AF071076    AF071077    AF231130    AC060812    AC090587    BC041136    BC012906    AF116074    BT007349    AL133601    AL137613    QUSF01000341    RLV82888.1    MKHE01000001    OWK18154.1    MUZQ01000308    OWK53034.1    KK502284    KFP22051.1    KL225752    KFM02752.1    ABGA01156939    ABGA01156940    ABGA01156941    ABGA01156942    ABGA01156943    ABGA01156944    ABGA01156945    ABGA01156946    ABGA01156947    ABGA01156948    NDHI03003437    PNJ51639.1    AB172654    BAE89716.1    JRES01000501    KNC30640.1    KB320452    ELW71834.1    JSUE03012860    JSUE03012861    JSUE03012862    JSUE03012863    JSUE03012864    JSUE03012865    JSUE03012866    JSUE03012867    JSUE03012868    CH473956    L39991    KL428082    KFW90844.1    NBAG03000591    PNI13999.1   

Proteomes

UP000005204    UP000053268    UP000007151    UP000069272    UP000092460    UP000092443    + More
UP000053760    UP000053584    UP000075920    UP000091820    UP000075900    UP000078200    UP000092445    UP000000673    UP000092444    UP000248483    UP000265300    UP000007062    UP000252040    UP000076407    UP000001519    UP000053641    UP000016665    UP000075903    UP000002356    UP000008912    UP000009136    UP000075883    UP000075881    UP000081671    UP000076408    UP000005447    UP000286642    UP000005640    UP000261680    UP000291021    UP000276834    UP000197619    UP000053119    UP000053286    UP000075885    UP000001595    UP000037069    UP000011518    UP000006718    UP000002494    UP000286640    UP000002279   

PRIDE

H9IX35    P52948    H7C3P6    P49793   

Pfam

PF12110   Nup96        + More
PF04096   Nucleoporin2
PF13634   Nucleoporin_FG

Interpro

IPR036903   Peptidase_S59_sf        + More
IPR021967   Nup96       
IPR007230   Peptidase_S59       
IPR037637   NUP98-NUP96       
IPR037665   Nucleoporin_S59-like       
IPR025574   Nucleoporin_FG_rpt       

SUPFAM

SSF82215   SSF82215       

Gene 3D

3.30.1610.10    

ProteinModelPortal

H9IX35   A0A194Q4W3   A0A2W1BLS0   A0A212F926   A0A2M4A068   A0A2M3ZZQ1   + More
A0A182FR72   A0A1B0B8F3   A0A034V6D0   A0A1A9Y2K9   A0A336LFV7   T1EAL4   A0A2M3ZZY1   A0A091G603   A0A2L2Y5W2   A0A336KXZ5   A0A2M4B8W5   A0A093HLV1   A0A182VQ92   A0A1A9WVG8   T1IPI4   A0A182RCW1   A0A093BPU1   A0A0K8U4G4   A0A1A9VGF5   A0A1A9ZUP2   W5JD26   A0A0K8WGH0   A0A1B0FAH0   A0A0A1WUD9   A0A0A1WPK7   K9IPD0   K9J3Z7   A0A093IB35   A0A093F2W3   A0A2Y9SDG7   A0A2Y9MHS6   A0A2Y9SEW8   A0A2Y9MKI0   A0A2Y9MKI4   A0A2Y9MH87   A0A2Y9S6R3   A0A340XVD3   Q7QBX5   A0A341AEL1   A0A341AA59   A0A182XID2   G3SH93   A0A099Z778   U3K6I4   A0A182VF73   W5NVX9   W5NVY1   G1LWU9   E1BCV4   D2HYT4   A0A087VHJ3   L8J2T2   A0A182MCY3   A0A182K2G3   A0A1S3F062   A0A182Y7A1   A0A1S3F055   H0V7X8   A0A2M3ZFG0   A0A3Q7Y6Z4   P52948-6   A0A384DEQ7   A0A3Q7Y108   A0A3Q7WLC0   A0A3Q7Y6Z8   A0A384DER3   A0A384DF97   P52948   P52948-5   A0A3L8RTL3   A0A212DJ24   A0A218UH21   A0A091KE74   A0A087QNE8   A0A182PA24   H2NEI3   A0A2J8V286   I7G613   A0A0L0CEF9   L9LAX6   H9H2Z0   H7C3P6   P49793   A0A093T8F8   A0A2J8IU24   A0A3Q7TM51   A0A3Q7TYV9   F6R2Q1  

PDB

5A9Q     E-value=3.0529e-18,     Score=224

KEGG

101746229    K14297 nuclear pore complex protein Nup98-Nup96 | (RefSeq) nuclear pore complex protein Nup98-Nup96

PATHWAY

03013    RNA transport - Bombyx mori (domestic silkworm)

GO

GO:0005643   GO:0017056   GO:0031080   GO:0016973   GO:0044614   GO:0006405   GO:0006606   GO:0034398   GO:0003723   GO:0008139   GO:0000973   GO:0003729   GO:1990904   GO:0034399   GO:0000776   GO:0003713   GO:0042405   GO:1990841   GO:0048026   GO:0006260   GO:0051292   GO:0016604   GO:0044615   GO:0031965   GO:0060964   GO:0008236   GO:0005635   GO:0019083   GO:0006409   GO:0005215   GO:0005829   GO:0005654   GO:0006406   GO:0043657   GO:0043231   GO:0006110   GO:0075733   GO:0006999   GO:0016925   GO:0016032   GO:1900034   GO:0006913   GO:0051028   GO:0042277  

PANTHER

PTHR23198:SF6   PTHR23198  

Subcellular location

Nucleus membrane   Localized to the nucleoplasmic side of the nuclear pore complex (NPC), at or near the nucleoplasmic basket (PubMed:11839768). Dissociates from the dissasembled NPC structure early during prophase of mitosis (PubMed:12802065). Colocalized with NUP153 and TPR to the nuclear basket of NPC (PubMed:11839768). Colocalized with DHX9 in diffuse and discrete intranuclear foci (GLFG-body) (PubMed:11839768, PubMed:28221134). Remains localized to the nuclear membrane after poliovirus (PV) infection (PubMed:11106761).   With evidence from 21 publications.
Nucleus   Localized to the nucleoplasmic side of the nuclear pore complex (NPC), at or near the nucleoplasmic basket (PubMed:11839768). Dissociates from the dissasembled NPC structure early during prophase of mitosis (PubMed:12802065). Colocalized with NUP153 and TPR to the nuclear basket of NPC (PubMed:11839768). Colocalized with DHX9 in diffuse and discrete intranuclear foci (GLFG-body) (PubMed:11839768, PubMed:28221134). Remains localized to the nuclear membrane after poliovirus (PV) infection (PubMed:11106761).   With evidence from 21 publications.
Nuclear pore complex   Localized to the nucleoplasmic side of the nuclear pore complex (NPC), at or near the nucleoplasmic basket (PubMed:11839768). Dissociates from the dissasembled NPC structure early during prophase of mitosis (PubMed:12802065). Colocalized with NUP153 and TPR to the nuclear basket of NPC (PubMed:11839768). Colocalized with DHX9 in diffuse and discrete intranuclear foci (GLFG-body) (PubMed:11839768, PubMed:28221134). Remains localized to the nuclear membrane after poliovirus (PV) infection (PubMed:11106761).   With evidence from 21 publications.
Nucleoplasm   Localized to the nucleoplasmic side of the nuclear pore complex (NPC), at or near the nucleoplasmic basket (PubMed:11839768). Dissociates from the dissasembled NPC structure early during prophase of mitosis (PubMed:12802065). Colocalized with NUP153 and TPR to the nuclear basket of NPC (PubMed:11839768). Colocalized with DHX9 in diffuse and discrete intranuclear foci (GLFG-body) (PubMed:11839768, PubMed:28221134). Remains localized to the nuclear membrane after poliovirus (PV) infection (PubMed:11106761).   With evidence from 21 publications.

Length:

326

Number of predicted TMHs:

0

Exp number of AAs in TMHs:

0.01182

Exp number, first 60 AAs:

0.002

Total prob of N-in:

0.00734

outside

1  -  326

 

 

Pi

177.461745

Theta

143.315462

Tajima's D

0.079136

CLR

0.173129

CSRT

0.390430478476076

Interpretation

Uncertain