SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO06235  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA001638
Annotation
PREDICTED:_xaa-Pro_aminopeptidase_1_[Bombyx_mori]
Full name
Xaa-Pro aminopeptidase ApepP      
Alternative Name
Aminopeptidase P
Location in the cell
Cytoplasmic   Reliability : 1.625 Mitochondrial   Reliability : 1.61
 

Sequence

CDS
ATGCTAGCCGTCGCACTGATCGTCATTTTAACAGTCAAATGTAGCCTGACAGAAGGCGCTTTGGCCAGTAACAGTTCTATCGACCGAAAAGATCGCAACCGCGAGATGTCGCTACAGCGCTTGCAAGCGCTCCGAGCGCTAATGTCGAGTCAGCGTCCCGTGTTGGCAGCTTATATTATACCGACCGCCGATGCTCATAATTCGGAGTACATAGATGCAGCGGACGCCAGACGCGAGTGGATATCCGCCTTCACCGGGTCGGCTGGCACTGCAGTTGTGACGTCATCGCAGGCTCTCGTCTGGACCGACGGTAGATACTACACGCAGTTCGAGAGGGAGGTCGACTTGTCAGCGTGGACTTTAATGAAACAGACACTACCGGACACTCCCACTTTGGAGAAATGGCTGGCCTCGAACCTCAAAGACGGTGACGTAGTCGGCGTGGATCCCCAAACGATGACCAGAGACGAATGGACTCCGATACAGACTGCCCTAAAGAAAATTAGCGCTCAACTAGTGCCGATTTCGAACAACCTCGTGGATGATGTCAGGATTGAACTTGGGGACCCGGCGCCTAAGAGATCGCACAATGAACTCGCGCCATTACACGTCCGCTACACTGGCAGAACAGCGGGAGAGAAGATCGCGGAATTAAGACGGAAGATGGCGGAGAAGAAAGCTTCGGCCCTCGTTCTAACGGCCTTAGACGATATTGCTTACACGTTAAATCTACGCGGCTCCGACATCGAATATAATCCGGTCTTCTTTTCGTACCTGATCGTGATGGAGACCAATGTTGTTCTATACTGGGGCGACGGTCAACTGCCCCCCTCCGTGACGGATCACCTGAGGGAGGAGGGCGTGGACAGTGTCGAGGGCAAACCTTACGGGGACATTTTGGAGGGCTTAAAGGAAATGGCGCGAGAACTGTCGGAGAGCGGCGACGGGAGACACGTGATCTGGTTGTCCAATGACGCTAATGAGGCGATCCACAGAGCCGCCTCCGGGTCTGATGTCCTAAAGCGTCCGATTGATTTAATATCGGAGGTGTCGCCCGTGAAACTGGCTAAATTGGTCAAAAACGAAATCGAACTGCAAGGCTTCCGTAACTGCCACATCAAGGACGGTATAGCCGTGGTCAGGTTCTTCAGGTGGCTCCACGATCAAATTGACAGCGGCGAGCAGATCACAGAGGTGCAGGCTTCGGATAAACTTCTGGAGTTTAGGAGGGACGAAAAGGACTTCATGGGTCCTTCGTTTGGAACGATAGCGGGCAGCGGCGCGAACGGCGCAATCATACACTACAGCCCCGATAGAGAGGGACAGCAGACCGTGATAGAGAGAGACCACATGTTCCTTCTCGACTCCGGCGGGCAATACAGGGATGGCACGACCGACATAACTCGCACGCGGCACATGAGCGGCAACCCTACCGCGGAACAGAAGGATGCGTTCACTCGAGTGCTAAAAGGTCAGATTATGATCGGCAGCGCTTTATTCCCGAAAGGCGTTAAGGGCAACGTTCTGGACAGCTTCGCGCGTCACGCCCTGTGGGAGGTGGGCCTGGACTACGGTCACGGGACGGGTCACGGCGTGGGTCACTACCTCAACGTGCACGAGGGTCCGTCCGGAGTCTCTTGGCGTCCGTACCCCGACGATCCTGGACTGAACGTTGGACAGATATTGAGCAACGAACCAGGCTTCTACAAAGTCGGCGAATACGGAATTCGCCACGAAGATCTAATAGAGATTGTGGCTGTCGATAAGGGAAGCGATCATCCTAAGGCGAAGAATCTGAGAGGCGATTACGATGGTCGAGGCGTTTTGGGCTTCAGCACGTTGACTTTAGTGCCCAATCAAAGGGAATGTATCGATGCAGAGATTATGACCGATTTCGAGATTTCATACGTGAACGCGTACCATCGAAGAGTGCTTGACACATTGAGTCCGATACTGAAGGAGCGCGGTTTGCTTAAGGATTTGGAGTGGCTCGAAGGTCAATGCATCCCGATAACCAGGAAGTGA
Protein
MLAVALIVILTVKCSLTEGALASNSSIDRKDRNREMSLQRLQALRALMSSQRPVLAAYIIPTADAHNSEYIDAADARREWISAFTGSAGTAVVTSSQALVWTDGRYYTQFEREVDLSAWTLMKQTLPDTPTLEKWLASNLKDGDVVGVDPQTMTRDEWTPIQTALKKISAQLVPISNNLVDDVRIELGDPAPKRSHNELAPLHVRYTGRTAGEKIAELRRKMAEKKASALVLTALDDIAYTLNLRGSDIEYNPVFFSYLIVMETNVVLYWGDGQLPPSVTDHLREEGVDSVEGKPYGDILEGLKEMARELSESGDGRHVIWLSNDANEAIHRAASGSDVLKRPIDLISEVSPVKLAKLVKNEIELQGFRNCHIKDGIAVVRFFRWLHDQIDSGEQITEVQASDKLLEFRRDEKDFMGPSFGTIAGSGANGAIIHYSPDREGQQTVIERDHMFLLDSGGQYRDGTTDITRTRHMSGNPTAEQKDAFTRVLKGQIMIGSALFPKGVKGNVLDSFARHALWEVGLDYGHGTGHGVGHYLNVHEGPSGVSWRPYPDDPGLNVGQILSNEPGFYKVGEYGIRHEDLIEIVAVDKGSDHPKAKNLRGDYDGRGVLGFSTLTLVPNQRECIDAEIMTDFEISYVNAYHRRVLDTLSPILKERGLLKDLEWLEGQCIPITRK

Summary

Description
Catalyzes the removal of a penultimate prolyl residue from the N-termini of peptides, such as Arg-Pro-Pro.
Catalytic Activity
Release of any N-terminal amino acid, including proline, that is linked to proline, even from a dipeptide or tripeptide.
Cofactor
Mn(2+)
Biophysicochemical Properties
Optimum pH is 7.6.
Similarity
Belongs to the peptidase M24B family.
Keywords
Aminopeptidase   Complete proteome   Cytoplasm   Hydrolase   Manganese   Metal-binding   Protease   Reference proteome  
Feature
chain  Xaa-Pro aminopeptidase ApepP
EC Number
3.4.11.9
EMBL
BABH01021246    NWSH01000280    PCG77804.1    KQ459463    KPJ00479.1    KQ459920    + More
KPJ19323.1    KPJ00495.1    JF262040    ADZ74177.1    ODYU01008066    SOQ51348.1    NWSH01001426    PCG71273.1    LJIG01022812    KRT78593.1    GBXI01001615    JAD12677.1    KQ971343    EFA04188.1    AXCN02001401    AXCM01002320    GFDG01001277    JAV17522.1    GFDG01001280    JAV17519.1    GFDG01001283    JAV17516.1    GFDG01001281    JAV17518.1    GFDG01001282    JAV17517.1    GAKP01022691    JAC36261.1    AAAB01008811    EAL41692.4    GDHF01009720    JAI42594.1    GGFM01002936    MBW23687.1    GFDL01000869    JAV34176.1    APCN01004825    GDAI01000081    JAI17522.1    CH477612    EAT38334.1    EAT38333.1    GAMD01003444    JAA98146.1    GGFJ01003395    MBW52536.1    CM000070    EDY68177.2    CVRI01000054    CRL00590.1    GGFJ01003396    MBW52537.1    GEZM01029634    JAV86027.1    CH902620    EDV30956.1    GAPW01000577    JAC13021.1    ADMH02000792    ETN65044.1    OUUW01000007    SPP83259.1    CH479182    EDW33892.1    GGFK01006280    MBW39601.1    GAMC01002794    JAC03762.1    GGFK01006293    MBW39614.1    AJ131920    CAA10526.2    AY082012    AE014134    AY061297    AAL28845.1    AAL99293.1    CH964232    EDW81212.2    DS234988    EEB09868.1    CM002910    KMY90641.1    GDIQ01148334    JAL03392.1    GDIP01058753    JAM44962.1    GDIP01107138    JAL96576.1    CM000158    EDW90203.1    GDIP01196076    GDIP01081431    JAJ27326.1    CH954179    EDV54874.1    GDIP01038153    JAM65562.1    GDIQ01090633    JAN04104.1    GDIP01041094    JAM62621.1    GDIP01040200    JAM63515.1    CM000361    EDX05285.1    GDIP01215680    JAJ07722.1    GFDF01001142    JAV12942.1    GFDF01001143    JAV12941.1    GDIP01104536    JAL99178.1    GDIQ01145525    GDIQ01093087    GDIQ01030273    JAL58639.1    GDIQ01152570    JAK99155.1    GDIQ01191342    GDIQ01036630    JAK60383.1    GDIQ01108886    GDIQ01052418    JAN42319.1    GDIP01239376    JAI84025.1    GDIQ01155365    JAK96360.1    GDIQ01088145    GDIQ01086396    JAN06592.1    GDIP01094597    JAM09118.1    KA646762    AFP61391.1    GDIP01238077    JAI85324.1    GDIQ01229144    JAK22581.1    CH933809    EDW19258.2    ACPB03006450    GAHY01001269    JAA76241.1    KK852543    KDR21696.1    GDKW01001241    JAI55354.1    NEVH01021955    PNF19004.1   
Pfam
PF00557   Peptidase_M24        + More
PF01321   Creatinase_N
PF16188   Peptidase_M24_C
Interpro
IPR000587   Creatinase_N        + More
IPR000994   Pept_M24       
IPR036005   Creatinase/aminopeptidase-like       
IPR029149   Creatin/AminoP/Spt16_NTD       
IPR033740   Pept_M24B       
IPR032416   Peptidase_M24_C       
IPR001131   Peptidase_M24B_aminopep-P_CS       
SUPFAM
SSF55920   SSF55920        + More
SSF53092   SSF53092       
Gene 3D
PDB
3CTZ     E-value=1.16215e-133,     Score=1223

Ontologies

Topology

Subcellular location
Cytoplasm  
SignalP
Position:   1 - 19,         Likelihood:  0.752820
 
 
Length:
674
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.9563
Exp number, first 60 AAs:
0.47144
Total prob of N-in:
0.01115
outside
1  -  674
 
 

Population Genetic Test Statistics

Pi
257.893549
Theta
218.959086
Tajima's D
1.750412
CLR
0.120774
CSRT
0.84110794460277
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
26822097 WIASNIKDGDVVGVDPQTMTR 96.00 3e-10
28556443 GVLGFSTLTLVPNQR 100.00 1e-04
28556443 VLDTLSPILK 100.00 2e-04
28556443 DHMFLLDSGGQYR 100.00 5e-04
28556443 LYDKNENGLMLGAELTHTLLALGEK 100.00 0.002
26822097 AASGSDVIK 100.00 0.006
26280517 DFGHFYGSSYVTAPDGSR 100.00 0.006
25044914 DGDTSIQSESSPAIK 100.00 0.006
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号