SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO06148  Validated by peptides from experiments
Annotation
PREDICTED:_gelsolin-like_[Amyelois_transitella]
Full name
Gelsolin      
Location in the cell
Cytoplasmic   Reliability : 2.152
 

Sequence

CDS
ATGCCTGAAGTACACCAAGCATTCGCGGATGCCGGCAGGAAGCCGGGTCTCGAAATATGGAGGATTGAGAACTTCGAACCGGTCGCCGTTCCGAAGACTCAGTTTGGTCTCTTCTACTCTGGGGACTCCTATATTGTACTGAACACCACAGGCGATAAGGACCGTCTAACATGGGACATCCACTTCTGGCTCGGCTCAAGGACCAGCCAGGACGAAGCCGGCGCGGCGGCCATCCTCACGGTGAACTTGGACGACGAACAATTCCAGGGATCAGCGGTACAGCACCGAGAGGTCCAATATTACGAGTCCAAGGAGTTCCTGGAATATTTCTCGCCAGCCATCCGCTACTTAAAAGGCGGACACGCCTCAGGCTTCAGCCACGTGACGATCAATGAGGGAACAGAGAAACGACTCTTCCAGATCAAGGGTAAAAGAAACGTCCGCGTTAAGCAGACACAGTCCTCTGCAGCTCTGTACTGA
Protein
MPEVHQAFADAGRKPGLEIWRIENFEPVAVPKTQFGLFYSGDSYIVLNTTGDKDRLTWDIHFWLGSRTSQDEAGAAAILTVNLDDEQFQGSAVQHREVQYYESKEFLEYFSPAIRYLKGGHASGFSHVTINEGTEKRLFQIKGKRNVRVKQTQSSAALY

Summary

Description
Calcium-regulated, actin-modulating protein that binds to the plus (or barbed) ends of actin monomers or filaments, preventing monomer exchange (end-blocking or capping). It can promote the assembly of monomers into filaments (nucleation) as well as sever filaments already formed.
Subunit
Binds to actin and to fibronectin.
Similarity
Belongs to the villin/gelsolin family.
Keywords
Actin-binding   Alternative splicing   Calcium   Complete proteome   Cytoplasm   Cytoskeleton   Metal-binding   Phosphoprotein   Reference proteome   Repeat   Secreted   Signal  
Feature
chain  Gelsolin
splice variant  In isoform 2.
EMBL
BABH01021068    KQ458725    KPJ05340.1    KZ150657    PZC70405.1    GAIX01009520    + More
JAA83040.1    GBHO01033317    GBHO01031979    JAG10287.1    JAG11625.1    GBRD01007159    JAG58662.1    GBHO01005588    JAG38016.1    CCAG010002582    CCAG010002583    GAKP01020261    GAKP01020260    JAC38692.1    KZ150427    PZC70920.1    GBRD01007158    JAG58663.1    GDHF01008411    JAI43903.1    GAMC01012223    JAB94332.1    GDHF01002830    JAI49484.1    UFQT01001498    SSX30818.1    SSX30817.1    UFQS01001020    UFQT01001020    SSX08604.1    SSX28520.1    GAMC01006570    JAB99985.1    KQ460736    KPJ12596.1    NWSH01000756    PCG74392.1    JRES01000310    KNC32416.1    CH954181    EDV47747.1    CM000364    EDX11565.1    GBXI01017400    GBXI01008256    JAC96891.1    JAD06036.1    ODYU01013020    SOQ59632.1    CH480821    EDW54795.1    OUUW01000014    SPP88317.1    CH902617    KPU79940.1    EDV42840.1    KA646135    AFP60764.1    CP012526    ALC45823.1    CM000160    EDW95627.1    KRK02572.1    CH479185    EDW37945.1    GDHF01032030    GDHF01001868    JAI20284.1    JAI50446.1    GAKP01015189    GAKP01015188    JAC43764.1    CM000070    EIM52893.1    GAKP01015191    GAKP01015190    JAC43762.1    GBXI01005705    JAD08587.1    GDHF01015067    GDHF01010278    JAI37247.1    JAI42036.1    EAL28778.1    KPJ05342.1    AK401881    BAM18503.1    ATLV01022193    KE525329    KFB47217.1    CH933806    EDW16986.1    KRG02434.1    KRG02435.1    KRG02433.1    CVRI01000008    CRK88567.1    AE014297    AAO41509.3    L08794    X75629    X75630    AY119662    BT031288    AAF52163.1    CH964251    EDW83060.2    CH940656    EDW58455.1    KRF78299.1    ABI31119.2    KZ149957    PZC76449.1    CH916373    EDV94564.1    GFDF01000140    JAV13944.1    GFDF01000141    JAV13943.1    GFDF01000143    JAV13941.1    GFDF01000142    JAV13942.1    GFDF01000144    JAV13940.1    GFDF01000145    JAV13939.1    GECU01018237    JAS89469.1    GEDC01023154    JAS14144.1    GGFM01006237    MBW26988.1    GEMB01001542    JAS01616.1    GANO01002735    JAB57136.1    GFTR01005706    JAW10720.1    GGFM01000420    MBW21171.1    GGFM01000444    MBW21195.1    GGFJ01006296    MBW55437.1    GGFJ01006297    MBW55438.1    GGFK01000866    MBW34187.1    GDKW01002904    JAI53691.1    ADMH02000569    ETN65859.1    NEVH01006578    PNF37694.1    CH477374    EAT42353.1    EAT42357.1    GAPW01001920    JAC11678.1    PNF37691.1    PNF37692.1    GAPW01001912    JAC11686.1    AAAB01008966    KB632195    ERL89958.1    APGK01026644    KB740635    ENN79901.1   
Pfam
PF00626   Gelsolin        + More
PF00098   zf-CCHC
PF13961   DUF4219
PF13976   gag_pre-integrs
Interpro
IPR007122   Villin/Gelsolin        + More
IPR036180   Gelsolin-like_dom_sf       
IPR029006   ADF-H/Gelsolin-like_dom_sf       
IPR007123   Gelsolin-like_dom       
IPR030004   Gelsolin       
IPR001878   Znf_CCHC       
IPR036875   Znf_CCHC_sf       
IPR025314   DUF4219       
IPR025724   GAG-pre-integrase_dom       
SUPFAM
SSF82754   SSF82754        + More
SSF57756   SSF57756       
Gene 3D
PDB
3FFK     E-value=9.45637e-40,     Score=405

Ontologies

Topology

Subcellular location
  
Secreted  
Length:
159
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00519
Exp number, first 60 AAs:
0.00478
Total prob of N-in:
0.07726
outside
1  -  159
 
 

Population Genetic Test Statistics

Pi
21.32126
Theta
21.197858
Tajima's D
0.192316
CLR
0.262904
CSRT
0.424578771061447
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
28467696 GGHASGFSHVTINEGTEK 100.00 3e-07
28467696 GGGVVVIQEPAAR 100.00 2e-06
28556443 FFDALGSGNK 100.00 2e-06
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号