SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO06095
Annotation
NA
Location in the cell
Mitochondrial   Reliability : 2.022 Nuclear   Reliability : 1.843
 

Sequence

CDS
ATGGAACATACGGTACAAAATGCAGAGGGAACCGAAGTCCCTCCGCAGACCCAGAGGCTCCAAACGATCCGTGAGAATGGGATTATCGACAATCCGAACGGCCCTCCTCTGTATGGAGTCAAATGGAAGAAGCTGGTATTTGGGAGCCCCGGCCCAGAGATGGGAGCAGTACTCCACGCGAGGCCGGACTTGTGCTTTATAAAGCAAAAGCCTTTGTCCAGGCGTGAAGTACCGCTTCGCTCTGTTGAGGACTCCCAGCATTTTGGACGCCAACTTGGCTTTGCCTTCCAGATGACTCCGAAACTGGACATCGCTCGAAATCTCGACCCCAAGTATCCCAATACTCTCGGAAGGTTGCAGGGATACTCCTTGGAATTGCGGCGCCATGACAAAGGGGTCCTTCTTCGCAGTGAACGCGCAAACTTGTGTCTTTATCGGGTTAAATTGAACCAAGTTCAATTCACCCCATTCGGAGACTCGCCCCAGAGAGTTCTCCACTTCAGACACAAGTTTAGATCGTCTCTCTTGCACCGCGCTCCGAGAGAGACTCTGATGGCCGATATATCGCGCATCCCCCGTGCTGTCATCCGCATAGCAATGCATACCATCAATAGACAGCATGTCATTGATATACAGGATAAACTACTCCTAAACCACCCCTGCGTGCAACGAATCAATCCTTAA
Protein
MEHTVQNAEGTEVPPQTQRLQTIRENGIIDNPNGPPLYGVKWKKLVFGSPGPEMGAVLHARPDLCFIKQKPLSRREVPLRSVEDSQHFGRQLGFAFQMTPKLDIARNLDPKYPNTLGRLQGYSLELRRHDKGVLLRSERANLCLYRVKLNQVQFTPFGDSPQRVLHFRHKFRSSLLHRAPRETLMADISRIPRAVIRIAMHTINRQHVIDIQDKLLLNHPCVQRINP

Summary

Uniprot
ProteinModelPortal

Ontologies

GO

Topology

Length:
227
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00049
Exp number, first 60 AAs:
0.00032
Total prob of N-in:
0.09553
outside
1  -  227
 
 

Population Genetic Test Statistics

Pi
174.373647
Theta
121.450489
Tajima's D
2.385156
CLR
110.879752
CSRT
0.931753412329384
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号