Gene

KWMTBOMO06012

Pre Gene Modal

BGIBMGA002878

Annotation

PREDICTED:_E3_ubiquitin-protein_ligase_SIAH1-like_[Amyelois_transitella]

Location

Bomo_Chr10(-):16087672-16088801      View in EpiBrowser

Full name

E3 ubiquitin-protein ligase       + More
E3 ubiquitin-protein ligase SIAH1      
E3 ubiquitin-protein ligase SIAH1A      

Alternative Name

RING-type E3 ubiquitin transferase SIAH1
Seven in absentia homolog 1
Siah-1a
RING-type E3 ubiquitin transferase SIAH1A
Seven in absentia homolog 1a

Location in the cell

Extracellular   Reliability : 2.631

CDS

ATGAGCACGAACATCAAGCGGCGTGGAGCTAGTGGGTCCAGTTGTTCAGTGCCCGGAGTGCCGGCCCTCGTGAACGCGCCCACCGCCATGTCTGCCGACCTCGCCTCGCTGTTTGAGTGTCCCGTTTGCTTCGACTATGTGCTGCCCCCCATCCTACAGTGTCAGAGTGGGCACCTGGTGTGCTCTAGCTGCCGTCCCAAGCTGTCCTGCTGCCCGACGTGTCGCGGGCCCCTCGGAAATATTCGCAACCTTGCAATGGAAAAGGTTGCCAGTAATGTTATGTTCCCCTGTAAACATTCTAACACGGGCTGTACTGTGACTCTTGTGCACACGGAGAAAGCTGAACATGAAGAAGCTTGTGAATTCAGGCCGTACTCTTGTCCTTGTCCCGGGGCATCCTGCAAGTGGCAAGGTGGTCTTGATCAAGTAATGCCGCATCTAATGATGTCTCACAAAAGTATCACAACACTCCAAGGAGAAGATATAGTGTTCTTAGCTACGGACATCAATCTGCCCGGTGCGGTGGACTGGGTGATGATGCAGTCATGCTTCAATCATCATTTTATGTTAGTTTTAGAAAAACAAGAAAAATTTGATGGTCACCAGCAGTTCTTTGCAATTGTGCAACTTATAGGATCTCGTAAAGAAGCTGAAAACTTTGCATACCGATTGGAGTTGAACGGTCACAGGCGTCGGCTAACGTGGGAGGCAATGCCTAGATCCATTCACGAAGGAGTGTCATCGGCCATCATGAACTCAGACTGCCTGGTGTTTGATACATCACTTGCACAATTATTTGCAGATAATGGCAACCTTGGTATAAATGTCACAATATCTATTGCCTAA

Protein

MSTNIKRRGASGSSCSVPGVPALVNAPTAMSADLASLFECPVCFDYVLPPILQCQSGHLVCSSCRPKLSCCPTCRGPLGNIRNLAMEKVASNVMFPCKHSNTGCTVTLVHTEKAEHEEACEFRPYSCPCPGASCKWQGGLDQVMPHLMMSHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFNHHFMLVLEKQEKFDGHQQFFAIVQLIGSRKEAENFAYRLELNGHRRRLTWEAMPRSIHEGVSSAIMNSDCLVFDTSLAQLFADNGNLGINVTISIA

Description

E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.
E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Mediates E3 ubiquitin ligase activity either through direct binding to substrates or by functioning as the essential RING domain subunit of larger E3 complexes. Triggers the ubiquitin-mediated degradation of many substrates, including proteins involved in transcription regulation (ELL2, MYB, POU2AF1, PML and RBBP8), a cell surface receptor (DCC), cytoplasmic signal transduction molecules (KLF10/TIEG1 and NUMB), an antiapoptotic protein (BAG1), a microtubule motor protein (KIF22), a protein involved in synaptic vesicle function in neurons (SYP), a structural protein (CTNNB1) and SNCAIP. Confers constitutive instability to HIPK2 through proteasomal degradation. It is thereby involved in many cellular processes such as apoptosis, tumor suppression, cell cycle, axon guidance, transcription, spermatogenesis and TNF-alpha signaling. Has some overlapping function with SIAH2. Induces apoptosis in cooperation with PEG3 (By similarity). Upon nitric oxid (NO) generation that follows apoptotic stimulation, interacts with S-nitrosylated GAPDH, mediating the translocation of GAPDH to the nucleus. GAPDH acts as a stabilizer of SIAH1, facilitating the degradation of nuclear proteins.
E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Mediates E3 ubiquitin ligase activity either through direct binding to substrates or by functioning as the essential RING domain subunit of larger E3 complexes. Triggers the ubiquitin-mediated degradation of many substrates, including proteins involved in transcription regulation (ELL2, MYB, POU2AF1, PML and RBBP8), a cell surface receptor (DCC), the cell-surface receptor-type tyrosine kinase FLT3, the cytoplasmic signal transduction molecules (KLF10/TIEG1 and NUMB), an antiapoptotic protein (BAG1), a microtubule motor protein (KIF22), a protein involved in synaptic vesicle function in neurons (SYP), a structural protein (CTNNB1) and SNCAIP. Confers constitutive instability to HIPK2 through proteasomal degradation. It is thereby involved in many cellular processes such as apoptosis, tumor suppression, cell cycle, axon guidance, transcription, spermatogenesis and TNF-alpha signaling. Has some overlapping function with SIAH2. Required for completion of meiosis I in males. Induces apoptosis in cooperation with PEG3. Upon nitric oxid (NO) generation that follows apoptotic stimulation, interacts with S-nitrosylated GAPDH, mediating the translocation of GAPDH to the nucleus. GAPDH acts as a stabilizer of SIAH1, facilitating the degradation of nuclear proteins.

Catalytic Activity

S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.

Subunit

Homodimer. Component of some large E3 complex composed of UBE2D1, SIAH1, CACYBP/SIP, SKP1, APC and TBL1X. Interacts with UBE2I. Interacts with alpha-tubulin. Interacts with PEG10, which may inhibit its activity. Interacts with PEG3 and HIPK2 (By similarity). Interacts with group 1 glutamate receptors GRM1 and GRM5. Interacts with DAB1, which may inhibit its activity. Interacts with UBE2E2. Interacts with SNCAIP. Interacts with GAPDH; leading to stabilize SIAH1. Interacts with Bassoon/BSN and Piccolo/PLCO; these interactions negatively regulate SIAH1 E3 ligase activity.
Homodimer. Interacts with group 1 glutamate receptors GRM1 and GRM5. Interacts with SNCAIP and HIPK2. Interacts with GAPDH; leading to stabilize SIAH1 (By similarity). Interacts with UBE2E2. Component of some large E3 complex composed of UBE2D1, SIAH1, CACYBP/SIP, SKP1, APC and TBL1X. Interacts with UBE2I. Interacts with alpha-tubulin. Interacts with PEG10, which may inhibit its activity (By similarity). Interacts with DAB1, which may inhibit its activity. Interacts with PEG3 and KLF10. Interacts with Bassoon/BSN and Piccolo/PLCO; these interactions negatively regulate SIAH1 E3 ligase activity (By similarity).

Similarity

Belongs to the SINA (Seven in absentia) family.

Keywords

Apoptosis   Cell cycle   Complete proteome   Cytoplasm   Developmental protein   Differentiation   Metal-binding   Nucleus   Phosphoprotein   Reference proteome   Spermatogenesis   Transferase   Ubl conjugation pathway   Zinc   Zinc-finger   3D-structure  

Feature

chain  E3 ubiquitin-protein ligase SIAH1

Uniprot

H9J043   A0A2H1VVT7   A0A2A4JHU9   A0A1E1WCP6   A0A0L7LF71   A0A194Q597   + More
A0A0N1ID69   A0A212ENR1   A0A0L7QL16   A0A2A3E664   A0A088AUY2   E9J8J3   A0A026X146   E2AR13   A0A232EPE6   K7IXS9   A0A2M4CS26   A0A151J948   A0A195CBF1   F4X8E9   A0A195BG45   A0A195FEF5   A0A151X9K5   A0A2M4AML8   A0A2M4BUH1   E2BIC8   W5J851   A0A182XP75   A0A182FGN1   A0A182I1F1   A0A023ENJ2   A0A1Q3FDW3   B0WR23   A0A182N8A2   A0A182V3R4   A0A182KP01   A0A182TQB6   A7UU20   A0A2M3ZAW8   A0A182WJY4   A0A182QRE3   A0A182JPT7   A0A182PDT4   A0A182JA54   Q16VC2   A0A182SFK0   A0A1B6E409   A0A182MAV3   A0A182RQY7   A0A2P8XH90   A0A1B6IYU6   A0A1B6KMN2   A0A067RAC9   A0A1B6LNC6   A0A154PK96   A0A1B6FQ05   A0A0N0U3F8   A0A310SIX3   A0A1L8DTD7   T1JGZ3   A0A1B6FH26   A0A1B0CKQ2   A0A1W4XRZ4   A0A1W4Y1P1   A0A0P7VK51   A0A3B3RDE2   A0A3B3RG66   A0A087VR91   A0A093E6M3   A0A093NWQ0   A0A087QX40   A0A094LIQ3   V9KWL5   F1PEG8   A0A0P7UF77   A0A2S2R5R0   A0A226PW97   A9UK92   G3HYR1   Q920M9   P61092   A0A3Q0D5T2   A0A1U7SNJ0   G1Q079   A0A1W5A1I6   A2AHZ2   H9GL05   A0A093ELX1   A0A091L2H9   A0A2I0TS52   A0A091GRG3   A0A099ZSD4   A0A226NJP2   A0A3L8SGI9   A0A093QIV6   A0A091GB71   A0A091J4B7   A0A218UIX2   A0A3M0KD93   A0A091XSD1  

EC Number

2.3.2.27

Pubmed

19121390    26227816    26354079    22118469    21282665    24508170    + More
30249741    20798317    28648823    20075255    21719571    20920257    23761445    24945155    26483478    20966253    12364791    14747013    17210077    17510324    29403074    24845553    29240929    24402279    16341006    24621616    15632090    21804562    23929341    11786535    10469171    15064394    15951807    19224863    23403927    8404535    15489334    10681424    12646221    11884614    12417719    11742346    16615911    21993624    12040188    19468303    21881562    30282656   

EMBL

BABH01018930    ODYU01004441    SOQ44314.1    NWSH01001468    PCG71154.1    GDQN01006308    + More
GDQN01005627    JAT84746.1    JAT85427.1    JTDY01001368    KOB74055.1    KQ459472    KPJ00180.1    KQ461186    KPJ07387.1    AGBW02013618    OWR43128.1    KQ414934    KOC59317.1    KZ288356    PBC27198.1    GL769034    EFZ10860.1    KK107036    QOIP01000004    EZA62007.1    RLU23757.1    GL441846    EFN64159.1    NNAY01002981    OXU20186.1    GGFL01003962    MBW68140.1    KQ979433    KYN21566.1    KQ978068    KYM97531.1    GL888932    EGI57151.1    KQ976500    KYM83152.1    KQ981673    KYN38404.1    KQ982373    KYQ57051.1    GGFK01008712    MBW42033.1    GGFJ01007576    MBW56717.1    GL448504    EFN84516.1    ADMH02002104    ETN59040.1    APCN01000054    JXUM01009385    GAPW01003092    KQ560282    JAC10506.1    KXJ83313.1    GFDL01009336    JAV25709.1    DS232049    EDS33120.1    AAAB01008960    EDO63797.1    GGFM01004869    MBW25620.1    AXCN02000962    CH477597    EAT38510.1    GEDC01013669    GEDC01004654    JAS23629.1    JAS32644.1    AXCM01000220    PYGN01002137    PSN31370.1    GECU01032108    GECU01015630    JAS75598.1    JAS92076.1    GEBQ01027291    JAT12686.1    KK852597    KDR20576.1    GEBQ01014810    JAT25167.1    KQ434926    KZC11718.1    GECZ01017487    JAS52282.1    KQ435883    KOX69771.1    KQ767066    OAD53500.1    GFDF01004413    JAV09671.1    JH432213    GECZ01020284    JAS49485.1    AJWK01016514    JARO02001941    KPP74013.1    KL502682    KFO15133.1    KL237877    KFV10086.1    KL224832    KFW64547.1    KL225962    KFM05794.1    KL289011    KFZ69237.1    JW870488    AFP03006.1    AAEX03001637    AAEX03001638    AAEX03001639    JARO02005514    KPP66652.1    GGMS01015489    MBY84692.1    AWGT02000007    OXB83978.1    AY681965    CH474037    AAV87215.1    EDL87505.1    JH000941    KE671422    EGW00259.1    ERE80263.1    AF389476    AB067814    Z19579    BC046317    AAPE02059121    AL732294    CH466571    EDL40763.1    KL464655    KFV15541.1    KK552083    KFP34064.1    KZ507563    PKU36563.1    KL510309    KFO86206.1    KL898220    KGL85209.1    MCFN01000031    OXB67734.1    QUSF01000023    RLW01292.1    KL672024    KFW83992.1    KL447260    KFO71417.1    KL218569    KFP06651.1    MUZQ01000268    OWK53729.1    QRBI01000116    RMC09070.1    KK735806    KFR15856.1   

Proteomes

UP000005204    UP000218220    UP000037510    UP000053268    UP000053240    UP000007151    + More
UP000053825    UP000242457    UP000005203    UP000053097    UP000279307    UP000000311    UP000215335    UP000002358    UP000078492    UP000078542    UP000007755    UP000078540    UP000078541    UP000075809    UP000008237    UP000000673    UP000076407    UP000069272    UP000075840    UP000069940    UP000249989    UP000002320    UP000075884    UP000075903    UP000075882    UP000075902    UP000007062    UP000075920    UP000075886    UP000075881    UP000075885    UP000075880    UP000008820    UP000075901    UP000075883    UP000075900    UP000245037    UP000027135    UP000076502    UP000053105    UP000092461    UP000192224    UP000034805    UP000261540    UP000054081    UP000053286    UP000002254    UP000198419    UP000001075    UP000030759    UP000002494    UP000000589    UP000189706    UP000189705    UP000001074    UP000001646    UP000053641    UP000198323    UP000276834    UP000053258    UP000053760    UP000054308    UP000197619    UP000269221    UP000053605   

PRIDE

H9J043    A9UK92    Q920M9    P61092   

Pfam

PF03145   Sina

Interpro

IPR001841   Znf_RING        + More
IPR018121   7-in-absentia-prot_TRAF-dom       
IPR008974   TRAF-like       
IPR004162   SINA-like       
IPR013083   Znf_RING/FYVE/PHD       
IPR013010   Znf_SIAH       

SUPFAM

SSF49599   SSF49599       

Gene 3D

2.60.210.10     3.30.40.10    

ProteinModelPortal

H9J043   A0A2H1VVT7   A0A2A4JHU9   A0A1E1WCP6   A0A0L7LF71   A0A194Q597   + More
A0A0N1ID69   A0A212ENR1   A0A0L7QL16   A0A2A3E664   A0A088AUY2   E9J8J3   A0A026X146   E2AR13   A0A232EPE6   K7IXS9   A0A2M4CS26   A0A151J948   A0A195CBF1   F4X8E9   A0A195BG45   A0A195FEF5   A0A151X9K5   A0A2M4AML8   A0A2M4BUH1   E2BIC8   W5J851   A0A182XP75   A0A182FGN1   A0A182I1F1   A0A023ENJ2   A0A1Q3FDW3   B0WR23   A0A182N8A2   A0A182V3R4   A0A182KP01   A0A182TQB6   A7UU20   A0A2M3ZAW8   A0A182WJY4   A0A182QRE3   A0A182JPT7   A0A182PDT4   A0A182JA54   Q16VC2   A0A182SFK0   A0A1B6E409   A0A182MAV3   A0A182RQY7   A0A2P8XH90   A0A1B6IYU6   A0A1B6KMN2   A0A067RAC9   A0A1B6LNC6   A0A154PK96   A0A1B6FQ05   A0A0N0U3F8   A0A310SIX3   A0A1L8DTD7   T1JGZ3   A0A1B6FH26   A0A1B0CKQ2   A0A1W4XRZ4   A0A1W4Y1P1   A0A0P7VK51   A0A3B3RDE2   A0A3B3RG66   A0A087VR91   A0A093E6M3   A0A093NWQ0   A0A087QX40   A0A094LIQ3   V9KWL5   F1PEG8   A0A0P7UF77   A0A2S2R5R0   A0A226PW97   A9UK92   G3HYR1   Q920M9   P61092   A0A3Q0D5T2   A0A1U7SNJ0   G1Q079   A0A1W5A1I6   A2AHZ2   H9GL05   A0A093ELX1   A0A091L2H9   A0A2I0TS52   A0A091GRG3   A0A099ZSD4   A0A226NJP2   A0A3L8SGI9   A0A093QIV6   A0A091GB71   A0A091J4B7   A0A218UIX2   A0A3M0KD93   A0A091XSD1  

PDB

2A25     E-value=5.58513e-99,     Score=920

KEGG

101736301    K04506 E3 ubiquitin-protein ligase SIAH1 [EC:2.3.2.27] | (RefSeq) E3 ubiquitin-protein ligase SIAH1-

PATHWAY

04013    MAPK signaling pathway - fly - Bombyx mori (domestic silkworm)
04120    Ubiquitin mediated proteolysis - Bombyx mori (domestic silkworm)
04310    Wnt signaling pathway - Bombyx mori (domestic silkworm)

GO

GO:0006511   GO:0008270   GO:0007275   GO:0005634   GO:0016567   GO:0016874   GO:0042802   GO:0008022   GO:0031624   GO:2001244   GO:0061630   GO:0030877   GO:0043161   GO:0030154   GO:0051402   GO:0007283   GO:0005886   GO:0007049   GO:0005769   GO:0004842   GO:0005829   GO:0031648   GO:0007141   GO:0030163   GO:0097718   GO:0040014   GO:0042803   GO:0019005   GO:0043065   GO:0009791   GO:0046872   GO:0005515   GO:0007264   GO:0008026   GO:0016597  

PANTHER

PTHR45877  

Subcellular location

Cytoplasm  
Nucleus  

Length:

281

Number of predicted TMHs:

0

Exp number of AAs in TMHs:

0.17188

Exp number, first 60 AAs:

0.10753

Total prob of N-in:

0.17121

outside

1  -  281

 

 

Pi

17.777407

Theta

16.020448

Tajima's D

0.251713

CLR

0.978958

CSRT

0.441777911104445

Interpretation

Uncertain