SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO06001
Pre Gene Modal
BGIBMGA002883
Annotation
PREDICTED:_LOW_QUALITY_PROTEIN:_2-oxoglutarate_dehydrogenase?_mitochondrial-like_[Bombyx_mori]
Location in the cell
Cytoplasmic   Reliability : 2.333
 

Sequence

CDS
ATGCACGGAGACGCAGCGTTCTCTGGCCAGGGCGTTGTGTACGAGACAATGCATCTTGGAAACCTTCCGGCTTTTACCACACACGGTTCAATACACATTGTCTGCAACAACCAGATCGGGTACACGACGGATCCTAGGTTCGCGAGGAGCTCGCCTTACTGCTCTGACGTGGCGAAGTGTGTGGATGCTCCCGTGTTCCACGTGAACGCTGATGACGCGGAGGCCGTGGCGCACGTCGCGAGGGTCGCCATCGAGTACCGCTGCAAGTTCAAGAAGGACGTCGTGCTGGATCTGGTCTGCTATAGGCGCTTCGGGCACAGCGAAGAAGACGAGCCCATGTTCACTCAACCTTTCATGTACAAGAAAATTAAGAGCATGCAAACTGTTGATAAAATCTATGGCGAGAAACTGAAGGCAGAAGGTATAGTGACGGATGCCGATGTCAAGGGTTGGGAGAAAGAGTACATGGACACGCTAAATCGGCACTTTGAGCTCGCCAAGAAGGTCACCAAACTAAGCATTATGGATTGGATCGATACTCCATGGACTGGTTTCTTTGAGGCCAGAGATCCTAAGAAAGTAAGGTTTCAATAA
Protein
MHGDAAFSGQGVVYETMHLGNLPAFTTHGSIHIVCNNQIGYTTDPRFARSSPYCSDVAKCVDAPVFHVNADDAEAVAHVARVAIEYRCKFKKDVVLDLVCYRRFGHSEEDEPMFTQPFMYKKIKSMQTVDKIYGEKLKAEGIVTDADVKGWEKEYMDTLNRHFELAKKVTKLSIMDWIDTPWTGFFEARDPKKVRFQ

Summary

EMBL
AGBW02010898    OWR47555.1    KQ461175    KPJ08000.1    KQ459472    KPJ00172.1    + More
NWSH01003119    PCG66912.1    NWSH01001058    PCG72868.1    NWSH01000943    PCG73436.1    ODYU01009993    SOQ54773.1    GDAI01002277    JAI15326.1    LJIG01000119    KRT86821.1    GBXI01007316    JAD06976.1    GEZM01046472    GEZM01046471    GEZM01046470    GEZM01046468    GEZM01046466    JAV77215.1    GEZM01046467    GEZM01046465    JAV77220.1    KF647632    AHB50494.1    GAKP01006592    JAC52360.1    GAKP01006590    JAC52362.1    GDHF01026991    JAI25323.1    GBXI01014747    JAC99544.1    GDHF01005182    GDHF01003198    JAI47132.1    JAI49116.1    GAKP01006591    JAC52361.1    GAKP01006589    JAC52363.1    GDHF01020327    GDHF01008192    GDHF01002123    JAI31987.1    JAI44122.1    JAI50191.1    GAKP01006593    JAC52359.1    GBXI01005110    JAD09182.1    GAMC01007906    JAB98649.1    GDHF01009554    JAI42760.1    GBXI01002589    JAD11703.1    GAMC01007908    JAB98647.1    GAMC01007909    JAB98646.1    GAMC01007907    JAB98648.1    QCYY01001012    ROT81148.1    GFDF01001346    JAV12738.1    JXUM01011039    JXUM01011040    JXUM01011041    JXUM01011042    GFDF01001330    JAV12754.1    KA646852    AFP61481.1    BT001767    AAN71522.1    JXJN01010297    AJWK01011399    AJWK01011400    AJWK01011401    AJWK01011402    AJWK01011403    ODYU01005456    SOQ46333.1    GAPW01000081    JAC13517.1    CCAG010004394    CH477404    EAT41628.1    EAT41627.1    CAQQ02114576    CAQQ02114577    CAQQ02114578    JRES01000577    KNC30102.1    CH916366    EDV96569.1    CM000159    KRK02041.1    KRK02042.1    HACG01040525    HACG01040526    CEK87390.1    CEK87391.1    CM002912    KMZ00159.1    JXUM01045696    KQ561447    KXJ78560.1    CH954178    KQS44071.1    KQS44073.1    KQS44074.1    KRK02043.1    KRK02044.1    KRK02045.1    OUUW01000009    SPP85205.1    KMZ00158.1    KMZ00169.1    SPP85203.1    CH379070    KRT08819.1    KMZ00160.1    KMZ00164.1    KMZ00167.1    KMZ00162.1    CH940647    KRF84469.1    KRF84471.1    KQS44070.1    KQS44072.1    KRT08821.1    EAL30321.2    KRT08820.1    SPP85204.1    KRT08817.1    KRT08818.1    KQS44069.1    AE014296    BT012466    AAN11721.1    AAO41241.2    AAS93737.1    KMZ00163.1    KRF84468.1    KRF84470.1    BT003743    AAF49388.2    AAF49389.2    AAN11722.1    AAO41240.1    AAO41404.1    KMZ00165.1    KMZ00166.1    CH933809    KRG06207.1    KRG06211.1    KRK02039.1    CM000363    EDX10802.1    KMZ00156.1    CH480815    EDW41835.1    EDW94770.1    KRK02040.1    KMZ00157.1    KMZ00161.1    AAN11723.3    ABW08558.1    EDV52013.1    KQS44068.1    EDW69592.1    EDW18491.1    KRG06209.1    KRG06210.1    KRG06208.1    UFQS01002041    UFQT01002041    SSX13049.1    SSX32489.1    SSX13048.1    SSX32488.1    LNIX01000002    OXA60228.1    CH963847    KRF97620.1    CH902618    KPU78554.1    KRF97621.1   
Pfam
PF16078   2-oxogl_dehyd_N        + More
PF16870   OxoGdeHyase_C
PF02779   Transket_pyr
PF00676   E1_dh
Interpro
IPR005475   Transketolase-like_Pyr-bd        + More
IPR001017   DH_E1       
IPR031717   KGD_C       
IPR032106   2-oxogl_dehyd_N       
IPR011603   2oxoglutarate_DH_E1       
IPR042179   KGD_C_sf       
IPR029061   THDP-binding       
SUPFAM
SSF52518   SSF52518       
Gene 3D
PDB
2XT6     E-value=1.86156e-46,     Score=465

Ontologies

Topology

Length:
197
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.0633800000000001
Exp number, first 60 AAs:
0.06304
Total prob of N-in:
0.06418
outside
1  -  197
 
 

Population Genetic Test Statistics

Pi
14.832011
Theta
15.845288
Tajima's D
-0.192665
CLR
3.948146
CSRT
0.321633918304085
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号