SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO05964
Annotation
ORF2_[Bombyx_mori]
Location in the cell
Cytoplasmic   Reliability : 1.553 Mitochondrial   Reliability : 1.432
 

Sequence

CDS
ATGGGCACAAAACAACTTAATGTCATCCAAAGGGGCATCGCTCAAAAACTTTGTAAGGCATATCGCACGGTCTCCCTGAACTCGGCACTGTTAATGGCTGGGATATTCCCTTTGGATCTCCGAGTTCGAGAGGCAGCCTCTCTATATGAGGCCAAGAAGGGAGTATGCCAGTCATGGCTTGGGGACAGGGAGATCGAGCGAATGTCATCAGCAATGAACGCCCCTCATCCCGCAGAGCAACTGAGTCTGGAGTTTGGCAATCTGGTAGACGAGGAACAATATAACACCCTCAACCACCTTGATGTGAGAATCTTCACGGATGGGAGCAAGATTGAGGGCCGAGTTGGGGCCGCTTTATCCATTTGGGATGGTGAGGCCGAAATATGGTCCCACAAGCTTGCTCTCGCACCCTATTGCACCGTTTATCAGGCCGAACTTTTGGCTCTAAATTATGCAGTCAAAGAAGCCCAGCTCCGAAACGGGTCTACTTTTGGAGTCTTTAGCGACAGCAAAGCGGCATTCCTCACAGTCACTAATCACGGTTCCCTCCATCCACTAGCCGTAGACACCAGAAACATGCTGAAACAATGCACATTGCAAAATAAGACCGTTGCCCTATATTGGATAAAATCACACGCGGGGTTGGAGGGAAACGAGCGAGCAGATCAACTTGCTAAGGAAGCCGCTCTGCTGTCGAAAATGACAGACAGGCAGAACATTACGACCTGTGTCCCGTTTCATACGTCAAGCGAATTATCCGGGTTCACTACGGGGCACGGAGGGTTCTCCGAATACTTGGCTAGGTTCAAGCGTAAGGGGGACCCTTCGTGTGCCTGTGAACCTGGCATGCCGGAAACGGTCGAACACCTGCTGACTTGTTGTCCCATTTTTGGAAAGCAGAGGTTCGAGCTCGAAAATAAAATAAATATAAGTGTAAATAAGGAAAATTTGTGTAGATTAATTGCTGAAAAGTATGTGAAGGAACTGTTTATAGATTATGCTGTACAAATAGTAAAAGTAGTGAATAAGAAAAACAAAGATTAA
Protein
MGTKQLNVIQRGIAQKLCKAYRTVSLNSALLMAGIFPLDLRVREAASLYEAKKGVCQSWLGDREIERMSSAMNAPHPAEQLSLEFGNLVDEEQYNTLNHLDVRIFTDGSKIEGRVGAALSIWDGEAEIWSHKLALAPYCTVYQAELLALNYAVKEAQLRNGSTFGVFSDSKAAFLTVTNHGSLHPLAVDTRNMLKQCTLQNKTVALYWIKSHAGLEGNERADQLAKEAALLSKMTDRQNITTCVPFHTSSELSGFTTGHGGFSEYLARFKRKGDPSCACEPGMPETVEHLLTCCPIFGKQRFELENKINISVNKENLCRLIAEKYVKELFIDYAVQIVKVVNKKNKD

Summary

EMBL
D38414    BAA07467.1    KZ149985    PZC75691.1    AB046668    BAB21511.1    + More
AB211537    BAE44464.1    NWSH01001820    PCG70022.1    JTDY01002407    KOB71471.1    JTDY01003675    KOB69169.1    JTDY01000474    KOB77015.1    RSAL01000046    RVE50582.1    JTDY01004660    KOB67904.1    GFAH01000444    JAV47945.1    RSAL01000249    RVE43511.1    KP771712    AKU04650.1    GFTR01008639    JAW07787.1    IAAA01038678    LAA08500.1    KP771711    AKU04648.1    KK121445    KFM80483.1    KK114278    KFM62077.1    PYGN01001848    PSN32539.1    AF015813    AAB94039.1    KK115320    KFM64783.1    NCKU01007943    RWS02258.1    KK119736    KFM76600.1    GEFM01002205    JAP73591.1    KK119855    KFM76920.1    GEFM01006389    JAP69407.1    LBMM01027406    KMQ82197.1    KK119281    KFM75280.1    GEBQ01026019    JAT13958.1    GEBQ01028566    JAT11411.1    GEBQ01009291    GEBQ01001010    JAT30686.1    JAT38967.1    IAAA01042979    LAA10651.1    GGLE01001887    MBY06013.1    GANO01003537    JAB56334.1    GANO01003141    JAB56730.1    AAZX01005323    GEHC01000972    JAV46673.1    KQ979504    KYN21193.1    KK120149    KFM77633.1    AAZX01023184    GGMS01005252    MBY74455.1    HG529600    CDI54043.1    JXNT01000020    ODM14912.1    GFTR01008411    JAW08015.1    AAZX01016607    AAZX01023407    X59239    CAA41925.1    GEBQ01014684    JAT25293.1    EF413180    ABN58714.1    KK107273    EZA53766.1    GBBI01004515    JAC14197.1    GANO01003538    JAB56333.1    GANO01003539    JAB56332.1    GANO01003611    JAB56260.1    LRGB01002060    KZS09540.1    GANO01003612    JAB56259.1    GGMS01004695    MBY73898.1    GECU01020687    JAS87019.1   
Pfam
PF00075   RNase_H        + More
PF00078   RVT_1
PF14529   Exo_endo_phos_2
PF16012   DUF4780
PF09588   YqaJ
Interpro
IPR036691   Endo/exonu/phosph_ase_sf        + More
IPR012337   RNaseH-like_sf       
IPR005135   Endo/exonuclease/phosphatase       
IPR000477   RT_dom       
IPR036397   RNaseH_sf       
IPR002156   RNaseH_domain       
IPR001584   Integrase_cat-core       
IPR031961   DUF4780       
IPR011335   Restrct_endonuc-II-like       
IPR011604   Exonuc_phg/RecB_C       
IPR019080   YqaJ_viral_recombinase       
SUPFAM
SSF56219   SSF56219        + More
SSF53098   SSF53098       
SSF52980   SSF52980       
Gene 3D
PDB
4HKQ     E-value=0.000227133,     Score=105

Ontologies

Topology

Length:
347
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
6.21798999999999
Exp number, first 60 AAs:
6.20786
Total prob of N-in:
0.34520
outside
1  -  347
 
 

Population Genetic Test Statistics

Pi
0.021726
Theta
0.226318
Tajima's D
-1.009167
CLR
119.721009
CSRT
0
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号