SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO05960  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA002901
Annotation
PREDICTED:_esterase_FE4-like_[Bombyx_mori]
Full name
Carboxylic ester hydrolase      
Location in the cell
Cytoplasmic   Reliability : 0.925
 

Sequence

CDS
ATGCCTCATACTCTTCGTCTTCTGATGAGAGGTTCTTCAGCACCGCATCCATCAACAACGGGAGTCTCGTCACTCGCTGCATCGGTAGCATCAGGAACGAGTGGAGGGATAGACTCTGGCAAGCCGGCGGGGACTCATCAGGGGACTGAGGTCCGAAAATGGAAATTCGCGAAGTTTTTGGGCATACCGTACGCACTAGTTGATGAGAACAATCCTTTCGGGCCATCAGTATCACACCCTGGATTCGAAGAGACATTCGAAGCGTACGATGATTCCGTAGTTTGTCCTCAAGTTACTAAGGGCGTCGGAGTTGGTAGTCTCCAGTGTTTAAACCTGAACGTTTATGTCCCAAACACGGCTACATCGCGCAACAAGCGCCCCGTGATGATTTGGATTCACGGAGGAAGCTTCGCCACCGGCAGTGGGACAGGCAGGGACTTCTCCTACGACGACCTGGTCCGACATGACGTCATCGTTGTATCGGTCAACTACCGACTCGGACCCTACGGGTTCTTATGCTTGGACAGTCCTGATATTCCCGGCAACCAGGGTTTGAAGGATCAAGCTCTTGCTCTCAGATGGATTAAGGAAAATATCGAAGCGTTCGGCGGAGATGTTTCTAAAATAACCTTATTCGGAGAGAGTGCTGGCGGCGTCGCTGTCGATCTACACTTACTGACCGACAAAGATGAACTGTTCAATCAGGTGATCATTCAGAGTGGATCTGCTTTCTTTGCTGGGGGTATTAGAAAACCTAACAACCGTGTTCCAATAGAAATAGCGAGCCAACTGGGATTCGAAACTGATAACTTCGCAGAGGCGATAAAGTTTCTGGTCGATCAAGACCCCCACCTGGTGGTCGCAGCTAGCACTTCTCAAAGATCTACCTTAGGAGGCAACACCCTCAGACCTTGCCTAGAGAACAAATACGACGGAGTTGACAGTTTTCTTTCCGACTTTCCTGAAAATTTAAGGGCTAGAAACATTCCTGCTATTTATGGAGTAAACAATAAAGAATTTCTTACATTACATGCTTTTGTGACCCCAGAAGATTACGAGGTGACAGGAATTCGAGCTTTTCTGGAACGGGCTTTCAACTTGACCGATAGCGAGATGGAAGACCACGTGAGACATTTCTACATCGGAGACGAGACGCTGACCGAGAAGTTTTTCGATGAGTTTATAGATTTTGCATCGGACTATTACTACAACTACGGCGTCCAGCGGTCTATTAAGAAGTCATTGGCTGACGGTAACAAGGAGGTATATTACTACGTGTTCTCGTACGACGGAGGCAGGAATGCCATGAAGCAGTACCTCGGCATAACGGCGGAGGGCGCTGCGCACGCGGACGAGCTCGGCTACCTGCTGGCCGTGGATGCGGTCCCGGGACAACACATCGCCGAGGAGGACCAACTGATCATCGACAGGATCACTACTCTTTGGGCTAATTTTGCTAAATACGGCAACCCCACCCCTGAGCCGACGGACCTGCTGCCGGTCGTGTGGACGACAGTAGAAGGTAACAAGCGGCCGTATCTGGACATCGACACCGACCTGCAGCTCAGAAGCAGGCCCTTCCACCACCGGATGGCCTTCTGGGATCTCTTCTATAAGCTCTATGGAGAATTGGAGCGCAGGAACTAG
Protein
MPHTLRLLMRGSSAPHPSTTGVSSLAASVASGTSGGIDSGKPAGTHQGTEVRKWKFAKFLGIPYALVDENNPFGPSVSHPGFEETFEAYDDSVVCPQVTKGVGVGSLQCLNLNVYVPNTATSRNKRPVMIWIHGGSFATGSGTGRDFSYDDLVRHDVIVVSVNYRLGPYGFLCLDSPDIPGNQGLKDQALALRWIKENIEAFGGDVSKITLFGESAGGVAVDLHLLTDKDELFNQVIIQSGSAFFAGGIRKPNNRVPIEIASQLGFETDNFAEAIKFLVDQDPHLVVAASTSQRSTLGGNTLRPCLENKYDGVDSFLSDFPENLRARNIPAIYGVNNKEFLTLHAFVTPEDYEVTGIRAFLERAFNLTDSEMEDHVRHFYIGDETLTEKFFDEFIDFASDYYYNYGVQRSIKKSLADGNKEVYYYVFSYDGGRNAMKQYLGITAEGAAHADELGYLLAVDAVPGQHIAEEDQLIIDRITTLWANFAKYGNPTPEPTDLLPVVWTTVEGNKRPYLDIDTDLQLRSRPFHHRMAFWDLFYKLYGELERRN

Summary

Similarity
Belongs to the type-B carboxylesterase/lipase family.
Feature
chain  Carboxylic ester hydrolase
EC Number
3.1.1.-
EMBL
BABH01018991    BABH01018992    BABH01018995    BABH01019018    BABH01018984    BABH01018985    + More
NWSH01000660    PCG74962.1    KZ149903    PZC78410.1    ODYU01001845    SOQ38611.1    SOQ38612.1    KQ459564    KPI99621.1    BABH01021273    KQ460400    KPJ14974.1    NWSH01000356    PCG77070.1    JTDY01001549    KOB73566.1    SOQ38610.1    SOQ38609.1    KQ459606    KPI91074.1    PCG77069.1    KY021858    AQY62747.1    NWSH01000067    PCG79999.1    SOQ38607.1    SOQ38608.1    FJ997307    ADF43472.1    BABH01007753    KZ150007    PZC75160.1    BABH01001500    FJ997304    ADF43469.1    KY021842    AQY62731.1    SOQ38604.1    KQ459837    KPJ19757.1    KC200270    AGG20205.1    EU523536    ACB12415.1    ODYU01001525    SOQ37859.1    KPI91073.1    KPI99620.1    MG846884    AXY94736.1    KY304479    AUN86410.1    SOQ38605.1    AGBW02008309    OWR53771.1    KPI99618.1    ODYU01010533    SOQ55708.1    PCG74961.1    EU523532    ACB12411.1    KPI91075.1    JTDY01003780    KOB69017.1    PZC78409.1    PZC78414.1    OWR53772.1    FJ997305    ADF43470.1    PZC78412.1    FJ997306    ADF43471.1    SOQ38606.1    NWSH01000834    PCG73942.1    KPI99616.1    KPJ19760.1    ODYU01008680    SOQ52463.1    PZC78411.1    KY021841    AQY62730.1    KQ460205    KPJ17125.1    PCG74959.1    PCG74960.1    SOQ37858.1    KY021850    AQY62739.1    KZ150132    PZC73036.1    EU688968    ACD80422.1    KY021848    AQY62737.1    NWSH01001418    PCG71299.1    JTDY01003106    KOB70142.1    KJ023212    AIY69040.1    SOQ38613.1    RSAL01000258    RVE43394.1    RVE43396.1    ODYU01006598    SOQ48575.1    BABH01001182    KC200271    AGG20206.1    KQ460947    KPJ10567.1    JTDY01003509    KOB69443.1    KPI91162.1    KU375432    APD13874.1    FJ652455    ACV60239.1    JTDY01004572    KOB67996.1    DQ680829    ABH01082.1    KY021887    AQY62776.1    PCG74963.1    BABH01003066    EU523534    ACB12413.2    FJ556877    ACL83460.1    OWR53773.1    FJ997308    ADF43473.1    ODYU01002878    SOQ40908.1    NWSH01002285    PCG68674.1    NWSH01000400    PCG76673.1    KZ150117    PZC73246.1    KZ149946    PZC76749.1    ODYU01008254    SOQ51681.1    KP001149    AJN91194.1    KY021884    AQY62773.1    LC017770    BAR64784.1    MF687628    ATJ44554.1    PZC73247.1    JX306730    AFO65061.1   
Pfam
PF00135   COesterase
Interpro
IPR002018   CarbesteraseB        + More
IPR019826   Carboxylesterase_B_AS       
IPR002168   Lipase_GDXG_HIS_AS       
IPR029058   AB_hydrolase       
IPR000997   Cholinesterase       
SUPFAM
SSF53474   SSF53474       
Gene 3D
PDB
6EMI     E-value=2.45665e-46,     Score=469

Ontologies

Topology

Length:
548
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00777999999999999
Exp number, first 60 AAs:
0.00125
Total prob of N-in:
0.00114
outside
1  -  548
 
 

Population Genetic Test Statistics

Pi
170.138436
Theta
175.821796
Tajima's D
2.321928
CLR
679.571267
CSRT
0.923803809809509
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
28556443 YGNPTPEPTDLLPVVWSTVEGNK 95.65 2e-09
28556443 YGNPTPEPTDLLPVVWSTVEGNK 95.65 2e-09
28556443 RPYLDIDTDLQLK 95.65 2e-09
28556443 YGNPTPEPTDLLPVVWSTVEGNK 95.65 2e-09
28556443 VPIEIASQLGFK 95.65 2e-09
28556443 VPIEIASQLGFK 95.65 2e-09
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号