SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO05955
Annotation
PREDICTED:_uncharacterized_protein_LOC106138993_[Amyelois_transitella]
Location in the cell
Nuclear   Reliability : 2.924
 

Sequence

CDS
ATGAAAGAAATAGCACTGCATGGAAGAGTAGATGATGCTGCTTTAATGGAATACGTCATAGATGGTATCAATGATCCTGAATCTAACAAAGCAATTTTATATGGAGCTACAGATTTGAAAGATTTTCGAAAGAAGCTAGACATCTATAGTGATTTTCGAAAGAAGCTGGACGTTTATAGCGATTTTCAAAAGAAAATGAGTACACTATCATATGACCAGGTAGTTCCGCAAGTAAATGCAGATGCAGGGACAACGTCATTAAGAAAACCGCATTTTAAAAGATGCTACAACTGTGGTGATTTAGACCATCAATCCCCCGGCTGTACAAAGGGCATTAAATGCTTTAAGTGTAATAAATTCGGCCACAAGGGAAACGAATGTAAGAATAAAGCCAAGAAGTCTTTAATTATTCAGAAGAAAAACGAAGAAGAAAAAAATCCCTTACAAAAGTTCGGCTTACGGGTATACAAAGAAGTACTTATCAAAGGTGTTTTTACTACTCAGCTACAGATTGATGATGCTGTTACGGATATCAAATTTTACATTGTGGAAGATGATATAATACCTGTAAAGCTGATCATTGGCAACCCCATACTGCGTGAATTCGAAGTTAAGTTTACAAGAAATGGTATTGTAATGGAGAAGATTCCACTTTGTGCTATTGTTGTTGAGAAGGACGAGGTCAAAGAAGACTACAAGAAATTAAAAAAAGAAGATTACAAGAAGTTAGACAAAGAAGATTATAAGAAGTTAGAGAAAGAAGACTGCAAGAAGTTGGTTAAAGTACCTTACCAGAATCATTTCACACAAAATAGAATACTATACAAAGAGAAGAATGGAAGTAGACTTATCGCTGTACCAAAGAAGATGGATAAAGAAATTAAAAGAGAGAGTTATAGGAGAGGTCGACTAAAAGTTGAAAATTGGGAATGGAGGAGGTCCGATACATACGACTAG
Protein
MKEIALHGRVDDAALMEYVIDGINDPESNKAILYGATDLKDFRKKLDIYSDFRKKLDVYSDFQKKMSTLSYDQVVPQVNADAGTTSLRKPHFKRCYNCGDLDHQSPGCTKGIKCFKCNKFGHKGNECKNKAKKSLIIQKKNEEEKNPLQKFGLRVYKEVLIKGVFTTQLQIDDAVTDIKFYIVEDDIIPVKLIIGNPILREFEVKFTRNGIVMEKIPLCAIVVEKDEVKEDYKKLKKEDYKKLDKEDYKKLEKEDCKKLVKVPYQNHFTQNRILYKEKNGSRLIAVPKKMDKEIKRESYRRGRLKVENWEWRRSDTYD

Summary

Pfam
PF17921   Integrase_H2C2        + More
PF00078   RVT_1
PF00098   zf-CCHC
PF17917   RT_RNaseH
PF00665   rve
PF17919   RT_RNaseH_2
PF02037   SAP
PF00077   RVP
PF03732   Retrotrans_gag
Interpro
IPR041588   Integrase_H2C2        + More
IPR036397   RNaseH_sf       
IPR041373   RT_RNaseH       
IPR000477   RT_dom       
IPR021109   Peptidase_aspartic_dom_sf       
IPR012337   RNaseH-like_sf       
IPR036875   Znf_CCHC_sf       
IPR001878   Znf_CCHC       
IPR001584   Integrase_cat-core       
IPR041577   RT_RNaseH_2       
IPR001995   Peptidase_A2_cat       
IPR003034   SAP_dom       
IPR001969   Aspartic_peptidase_AS       
IPR018061   Retropepsins       
IPR005162   Retrotrans_gag_dom       
SUPFAM
SSF50630   SSF50630        + More
SSF53098   SSF53098       
SSF57756   SSF57756       
Gene 3D
PDB
2LLI     E-value=0.0012237,     Score=98

Ontologies

Topology

Length:
318
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.0002
Exp number, first 60 AAs:
0
Total prob of N-in:
0.02526
outside
1  -  318
 
 

Population Genetic Test Statistics

Pi
263.089415
Theta
167.430842
Tajima's D
1.386015
CLR
0.377272
CSRT
0.76031198440078
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号