SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO05945  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA002796
Annotation
PREDICTED:_esterase_FE4-like_[Bombyx_mori]
Location in the cell
PlasmaMembrane   Reliability : 3.414
 

Sequence

CDS
ATGGAGGGGTGCGGTATGAGTTGCATTAAATATTTACTCGTCGTTTTCAACGCTCTGTTTTTGATCTTCGGCGTGGTAATCATAGCGGCAGCATGTGTGGACATGGGATTAATCAAGGGCTTCGCTGGTATGGAGACCACGGGCCACGAAACGGACGCGGTCCTCATTGCTGTAGGAGTTCTCATCATATTAGTCGCTGCTTTTGGGTGTTTCGGAGCTTGGAAGGAAAGCACCAAGCTACTTTATATTGTGAGTAGAAATATGTTCTATGCACAAAGTTATTTTGGTGAAATTAAAGTTTAGTCTTATATAAAATATCTGACAGCGTCCAAACTGCGCATTGCTAGTGCAAGTATGCTGCGATCGGTTGCTCTATTGGGCTTGTTGTCGGCTGTGGGTGCCTGGTTGAGGATAGACCCGCTTGTTGAGACTCAACAGGGACTCATCAGGGGACTGAGGTCCGAAAATGGAAAGTTCTCGAAATTTCTGGGCATACCGTACGCACTAGTCGACGAAAAAAATCCTTTCGGGCCATCAGTACCACACCCTGGCTTCGAAGAGACATTCGAAGCGTACGATGATTCTGTAGTTTGTCCTCAAGTTATTAAAGTTACTAAAGTCGGAATTGGTAGTCTCCAGTGCTTGAACCTGAACGTTTATGTTCCAAACACGGCTACATCGCGCAACAAGCGCCCCGTGATGGTTTGGATCCACGGAGGAGGCTTCACTACCGGCAGCGGGACAAGTAGAGACTACTCCTACGACGACCTGGTCCGACATGACGTCATCGTCGTATCGGTCAACTACCGACTCGGACCCTATGGGTTCTTATGCTTGGACAGTCCCGATGTTCCCGGCAATCAGGGATTGAAAGACCAAGTTCTTGCATTGAAGTGGACTAAAGAAAATATCGAGGCATTCGGCGGAGATGCCTCTAAAATAACCATATTCGGAGAGAGTGCTGGAGGCCAAGCGGTCGAGTTGCACCTACTGACCGACCAAGATAAACTGTTCAATCAGGTGATTGTGCAGAGTGGCTCTATTTATAAGCCTGGGATCATCAATAAGCCTGACAATAGTGTCCCAATACAAATAGCGAGCCGGTTGGGATTCGAAACTGAGGACTTCGTAGCGGCGATATCGTTTCTGGCCGATCAAGACCCGCACCTTGTCGTGGCGGCTAGTACTTCCGAAGGCTCTACTGTATTTAGCGGTAGCGCATACAGAGCTTGCGTAGAAAACGAATTTGATGGGATTCACAGTTACCTCTCTGATTCTCCACAAAATTTAAAGATTAAAAACATTCCCGTGATTTATGGAGTGAATAGCAAAGAATATTTGACTTTGCATGCTTCATTAGTTCCGGAACAGTACGAAGTGTCAGGATTTAAGTCCTTCCTAAAATTGGCTTTCAACTTGACCGATGATGACATGGAAGAAGACGTGAGACATTTCTATATCGGAGACGAGACCCTGACTGAGGAGTTGTTCGATGAATTTATAACTTTTGCATCAGATTATTATTATGGTTACCCCGTCGAACGGTCCATTAAGAAGTCATTGGCTGACGGTAATAAGGAAATATATTACTACGTGTTCTCGTACGACGGAGGCAGAAATGCCATGAAGGAGTACCTTGGCATAACGGCGGCGGGCGTTGCGCACGCGGACGAGCTCGGCTACCTGCTGGCCGTGGATGCGGTCCCGGGACAACACATCGCCGAGGAGGACCAACTGATCATCGACAGGATCACTACTCTTTGGGCCAATTTTGCTAAATACGGCAACCCCACCCCTGAGCCGACGGACCTGCTGCCGGTCGTGTGGTCGACAGTAGAAGCGAGCGGCCGCCAACGCCGAATTGGCGTGGGCGGTCATCCTCAAACTCCGATCGATTTCGATCCCCAAGTACCGGACGCTGGATCTAAACTCGATATTAACGTCACAGAGACTGAGCTGTCCCGAGACGACTGTTGTGTGAACCGGACCGAAGAGAATAGCCGCGGTCTTTCCCACGTTGACCGCGACCCTCCATCGGTCCAGTCACTGGGGCAAAAGGCATTGATAATACTCACTGCCACCAGTCACGTCCAACGTCACGTCACCGGTAGGCCCTTAGCTATGGCCCTGGCATTGCTGAAGTCCATGATGTTTGCTGGATGCCTGATCATCATCATACTCCTCGAACTGTCGGTTGGCATCGCTGCGGCTGCTCTCCGTCCACAAATCGAAGGCACCATGAAGACTCAACTGCGAGCGTCCTTCATTAAGAACAAGTCCACTAAAGAAGAAGATTCCACTTACAGGGAATTCTGGGATAAAATTCAAAACAACTTGGAGTGCTGCGGAGTGACCGGGCCTGACAACTACGGCGCCTCGGAGCCGCGCCTCAACCCCTCGTTCAGCTGCTGCCCCCCAGACGACTCCGACCGCGCCGTGGAGATCAAGCGATCCGACTGCCTCTCCCTCGAGAAGTACTACAAGGAAGGGTGCGAGGACAAAGTGCTGTCCACGGTCCACAGCGCCGGCATGACCGTCATCGTGTGCGGGATACTGTTCTGTTTCTTGGAGGTGGCCGGCATAATTCTAGCGTTATGGTTGGCCCACGCCATTAAATCGGAGGGGAAGAGTCGGGAAACCGCCTAA
Protein
MEGCGMSCIKYLLVVFNALFLIFGVVIIAAACVDMGLIKGFAGMETTGHETDAVLIAVGVLIILVAAFGCFGAWKESTKLLYIVSRNMFYAQSYFGEIKVXSYIKYLTASKLRIASASMLRSVALLGLLSAVGAWLRIDPLVETQQGLIRGLRSENGKFSKFLGIPYALVDEKNPFGPSVPHPGFEETFEAYDDSVVCPQVIKVTKVGIGSLQCLNLNVYVPNTATSRNKRPVMVWIHGGGFTTGSGTSRDYSYDDLVRHDVIVVSVNYRLGPYGFLCLDSPDVPGNQGLKDQVLALKWTKENIEAFGGDASKITIFGESAGGQAVELHLLTDQDKLFNQVIVQSGSIYKPGIINKPDNSVPIQIASRLGFETEDFVAAISFLADQDPHLVVAASTSEGSTVFSGSAYRACVENEFDGIHSYLSDSPQNLKIKNIPVIYGVNSKEYLTLHASLVPEQYEVSGFKSFLKLAFNLTDDDMEEDVRHFYIGDETLTEELFDEFITFASDYYYGYPVERSIKKSLADGNKEIYYYVFSYDGGRNAMKEYLGITAAGVAHADELGYLLAVDAVPGQHIAEEDQLIIDRITTLWANFAKYGNPTPEPTDLLPVVWSTVEASGRQRRIGVGGHPQTPIDFDPQVPDAGSKLDINVTETELSRDDCCVNRTEENSRGLSHVDRDPPSVQSLGQKALIILTATSHVQRHVTGRPLAMALALLKSMMFAGCLIIIILLELSVGIAAAALRPQIEGTMKTQLRASFIKNKSTKEEDSTYREFWDKIQNNLECCGVTGPDNYGASEPRLNPSFSCCPPDDSDRAVEIKRSDCLSLEKYYKEGCEDKVLSTVHSAGMTVIVCGILFCFLEVAGIILALWLAHAIKSEGKSRETA

Summary

Uniprot
ProteinModelPortal
PDB
6EMI     E-value=2.64937e-44,     Score=453

Ontologies

Topology

Length:
881
Number of predicted TMHs:
5
Exp number of AAs in TMHs:
111.77371
Exp number, first 60 AAs:
30.8526
Total prob of N-in:
0.99521
POSSIBLE N-term signal
sequence
inside
1  -  10
TMhelix
11  -  33
outside
34  -  52
TMhelix
53  -  74
inside
75  -  113
TMhelix
114  -  136
outside
137  -  715
TMhelix
716  -  738
inside
739  -  845
TMhelix
846  -  868
outside
869  -  881
 
 

Population Genetic Test Statistics

Pi
246.092839
Theta
176.608461
Tajima's D
1.445767
CLR
0.374838
CSRT
0.774611269436528
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
28556443 IDPLVETQQGLIR 100.00 3e-09
28556443 ASDYYYGYPVER 100.00 0.013
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号