SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO05939
Annotation
NA
Location in the cell
Mitochondrial   Reliability : 1.745 Nuclear   Reliability : 1.917
 

Sequence

CDS
ATGGAACATACGGTACAAAATACAGAGGGAACCGAAGTCCCTCCGCAGACCCAGAGGCTCCAAACGATCCGTGAGAATGGGATTATCGACAATCCGAACGGCCCTCCTCTGTATGGAGTCAAATGGAAGAAGCTGGTATTTGGGAGCCCCGGCCCAGAGATGGGAGCAGTACTCCACGCGAGGCCGGACTTGTGCTTTATAAAGCAAAAGCCTTTGTCCAGGCGTGAAGTACCGCTTCGCTCTGTTGAGGACTCCCAGCATTTTGGACGCCAACTTGGCTTTGCCTTCCAAATGACTCCGAAACTGGACATCGCTCGAAATGTCGACCCCAAGTATCCCAATACTCTCGGAAGGTTGCAGGGATACTCCTTGGAGAAAAGTCTTTAA
Protein
MEHTVQNTEGTEVPPQTQRLQTIRENGIIDNPNGPPLYGVKWKKLVFGSPGPEMGAVLHARPDLCFIKQKPLSRREVPLRSVEDSQHFGRQLGFAFQMTPKLDIARNVDPKYPNTLGRLQGYSLEKSL

Summary

Uniprot
ProteinModelPortal

Ontologies

GO

Topology

Length:
128
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.0007
Exp number, first 60 AAs:
0.00061
Total prob of N-in:
0.30532
outside
1  -  128
 
 

Population Genetic Test Statistics

Pi
253.821396
Theta
140.879529
Tajima's D
2.728357
CLR
0
CSRT
0.96275186240688
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号