SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO05936
Annotation
reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 2.044 Nuclear   Reliability : 1.585
 

Sequence

CDS
ATGGCGCCGCAATTCCAAGGAGTATCCCTGCAACCTTCCGAGAGTATCGGGATACTTGGGGTCGACATTTCGAGCGATGTCCAGTTTCGGAGTCATTTGGAAGGCAAAGCCAAGTTGGCGTCCAAAATGCTGGGAGTCCTCAACAGAGCGAAGCGGTACTTCACGCCTGGACAAAGACTTTTGCTTTATAAAGCACAAGTCCGGCCTCGCATGGAGTGCTGCTCCCATCTCTGGGCCGGGGCTCCCAAATACCAGCTTCTTCCATTTGACTCCATACAGAGGAGGGCCGTTCGGATTGTCGATAATCCCATTCTCTCGGATCGTTTGGAGCCTCTGGGTCTGCGGAGGGACTTCGGTTCCCTCTGTATTTTGTACCGTATGTTCCATGGGGAGTGCTCTGAGGAATTGTTCGAGATGATACCAGCATCTCGTTTTTACCATCGCACCGCCCGCCACCGGAGTAGAGTTCATCCATACTACCTGGAGCCACTGCGGTCATCCACAGTGCGTTTCCAGAGATCTTTTTTGCCACGTACCATCCGGCTATGGAATGAGCTCCCCTCCACGGTGTTTCCCGAGCGCTATGACATGTCCTTCTTCAAACGAGGCTTATGGAGAGTATTAAGCGGTAGGCAGCGGCTTGGCTCTGCCCCTGGCATTGCTGAAGTCCATGGGCGACGGTAA
Protein
MAPQFQGVSLQPSESIGILGVDISSDVQFRSHLEGKAKLASKMLGVLNRAKRYFTPGQRLLLYKAQVRPRMECCSHLWAGAPKYQLLPFDSIQRRAVRIVDNPILSDRLEPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERYDMSFFKRGLWRVLSGRQRLGSAPGIAEVHGRR

Summary

Similarity
Belongs to the protein kinase superfamily. Tyr protein kinase family.
EMBL
AB126052    BAD86652.1    AY359886    AAQ57129.1    RSAL01002067    RVE40593.1    + More
RSAL01000487    RVE41561.1    RSAL01000164    RVE45343.1    RSAL01003136    RVE40332.1    RSAL01000002    RVE55041.1    RVE55094.1    ODYU01002162    SOQ39302.1    RVE54942.1    RSAL01000422    RVE41792.1    FM995623    CAX36785.1    AMCI01002135    EJX03495.1    HAAD01001474    CDG67706.1    ODYU01007424    SOQ50185.1    ODYU01007423    SOQ50184.1    GDRN01105059    JAI57791.1    LWDP01000391    ORD92879.1    RSAL01000193    RVE44603.1    DPOC01000269    HCX22453.1    RSAL01000030    RVE51708.1    RSAL01000058    RVE49758.1    RSAL01000110    RVE47159.1    GFAC01000919    JAT98269.1    MRZV01001153    PIK40187.1    GBBK01004986    JAC19496.1    GEFM01001453    JAP74343.1    GFAA01000199    JAU03236.1    GEGO01004630    JAR90774.1    GEGO01003111    JAR92293.1    AAGJ04112043    GEGO01001118    JAR94286.1    GEFM01002324    JAP73472.1    GANP01010920    JAB73548.1    GFAA01002514    JAU00921.1    GEFM01002394    JAP73402.1    GFAC01005670    JAT93518.1    GBIH01002577    JAC92133.1    AAGJ04095885    GFAC01005665    JAT93523.1    GEFM01006417    JAP69379.1    JH815916    EKC31648.1    GFAC01005646    JAT93542.1    GFAA01002657    JAU00778.1    GADI01003787    JAA70021.1    GDRN01111277    JAI56804.1    GFAA01002479    JAU00956.1    GEGO01003518    JAR91886.1    AAGJ04110620    AAGJ04028723    AAGJ04028724    AAGJ04028725    GFAA01002385    JAU01050.1    GEGO01002025    JAR93379.1    GEFM01001613    JAP74183.1    GBZX01002173    JAG90567.1    GEGO01004433    JAR90971.1    GGLE01003659    MBY07785.1    AAGJ04028970    GEGO01002473    JAR92931.1    GFAA01004201    JAT99233.1    GEFM01005909    JAP69887.1    NEDP02002733    OWF50189.1    GFAA01003161    JAU00274.1    GEFM01005882    JAP69914.1    AGCU01082246    GEGO01004304    JAR91100.1    AGCU01000442    AAGJ04079835    GFAC01000877    JAT98311.1    AGCU01122093    GEGO01004752    JAR90652.1    GEGO01003312    JAR92092.1    AGCU01063261   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF01873   eIF-5_eIF-2B
PF01585   G-patch
PF08159   NUC153
PF00458   WHEP-TRS
PF07714   Pkinase_Tyr
PF00086   Thyroglobulin_1
PF00083   Sugar_tr
Interpro
IPR000477   RT_dom        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR036691   Endo/exonu/phosph_ase_sf       
IPR016190   Transl_init_fac_IF2/IF5_Zn-bd       
IPR002735   Transl_init_fac_IF2/IF5       
IPR016189   Transl_init_fac_IF2/IF5_N       
IPR012677   Nucleotide-bd_a/b_plait_sf       
IPR000504   RRM_dom       
IPR034653   SPF45_RRM       
IPR003954   RRM_dom_euk       
IPR000467   G_patch_dom       
IPR040052   RBM17       
IPR035979   RBD_domain_sf       
IPR036322   WD40_repeat_dom_sf       
IPR040382   NOL10/Enp2       
IPR012580   NUC153       
IPR001680   WD40_repeat       
IPR000738   WHEP-TRS_dom       
IPR009068   S15_NS1_RNA-bd       
IPR000719   Prot_kinase_dom       
IPR008266   Tyr_kinase_AS       
IPR020635   Tyr_kinase_cat_dom       
IPR017441   Protein_kinase_ATP_BS       
IPR001245   Ser-Thr/Tyr_kinase_cat_dom       
IPR011009   Kinase-like_dom_sf       
IPR036857   Thyroglobulin_1_sf       
IPR000716   Thyroglobulin_1       
IPR036259   MFS_trans_sf       
IPR020846   MFS_dom       
IPR005828   MFS_sugar_transport-like       
IPR028082   Peripla_BP_I       
SUPFAM
SSF56219   SSF56219        + More
SSF75689   SSF75689       
SSF100966   SSF100966       
SSF54928   SSF54928       
SSF50978   SSF50978       
SSF47060   SSF47060       
SSF56112   SSF56112       
SSF57610   SSF57610       
SSF103473   SSF103473       
SSF53822   SSF53822       
Gene 3D

Ontologies

Topology

Length:
227
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00061
Exp number, first 60 AAs:
0.00055
Total prob of N-in:
0.01891
outside
1  -  227
 
 

Population Genetic Test Statistics

Pi
80.358187
Theta
76.766511
Tajima's D
0.114415
CLR
0
CSRT
0.402229888505575
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号