SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO05882
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 2.023 Nuclear   Reliability : 2.362
 

Sequence

CDS
ATGTATCTAGCCTATCGTCATGTATGGTTGCGAAACGTGGACCCTGAAAGAGGACACTACAAGACGCCTACAGGCATTCGAGATGTGGTGCTACCGTCGCATGTTACGCAGTTTAGTTGGACGCAGAGGGTCAGGAACGAAACCGTGCTTCAGCGCGTTCATATGTCCCGGAAAATGTTGCCTGCTATCAAAAAGCGCAAGATAGAGTATCTCGGCCACGTGCTCAGGAACGATCGATACATGCTGCTGCAGCTGATAATTATGGGCAAAGTGGACGGAAAGAGACGTGCTGGGCGAAGAAAAAAGTCATGGCTCCGGAATATCCGGGAGTGGACCAGTATTGCCTCCGTCGAACAGCTGTTCCGGCTGGCTGCTGACAGAAAGGAATACAGAAAACTAACGGCCAACCTTCAGGATTGA
Protein
MYLAYRHVWLRNVDPERGHYKTPTGIRDVVLPSHVTQFSWTQRVRNETVLQRVHMSRKMLPAIKKRKIEYLGHVLRNDRYMLLQLIIMGKVDGKRRAGRRKKSWLRNIREWTSIASVEQLFRLAADRKEYRKLTANLQD

Summary

Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
Interpro
IPR036691   Endo/exonu/phosph_ase_sf        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR000477   RT_dom       
IPR036640   ABC1_TM_sf       
SUPFAM
SSF56219   SSF56219        + More
SSF90123   SSF90123       
Gene 3D

Ontologies

Topology

Length:
139
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.0061
Exp number, first 60 AAs:
0.00016
Total prob of N-in:
0.18445
outside
1  -  139
 
 

Population Genetic Test Statistics

Pi
315.567165
Theta
198.608789
Tajima's D
1.853572
CLR
0
CSRT
0.854057297135143
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号