SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO05871
Pre Gene Modal
BGIBMGA002944
Annotation
alcohol_dehydrogenase_11?_partial_[Helicoverpa_assulta]
Location in the cell
Cytoplasmic   Reliability : 3.507
 

Sequence

CDS
ATGTATGATTTTAAAGAAAAAGTTGTACTGGTAACTGGCGGAGCCGCAGGCATCGGTGCTGGAGTAGTCGAAGCGGTACTGAAGGAAGGCGCCAAGCATATCGCAGCATTAGATGTGGATTCAGTTAACGGGAAAATCCTTGAAGACGAACTAAACGACAATTATAAAGGAAATAAAGTGAAGTTCTACAAATGCGATGTTACCAGCAATGATTTGGAAACGGTATACGATAATGTGATCAAAGAACATAAATATATAGACGTTGTCGTGAACTGCGCTGGTATAATGAATGATAGACCTAATGTATATCTAAAAGAGATAGCTGTTAATGTGACTGCTCTGATAACAAGCTCGTTCAAAGCCTACAATTTGATGCGCAAAGACCACGGCGGCAAAGGGGGAACAATAATTAATATTTCGTCTATCGTTGGATTATTCCAAGCAAGTCTTTTGCCTGTGTATGCGGCCACCAAAAGCGCAGTTTTGCAATTCAGTACTTGTTTGGGAATGGAGCCGCATTATAGTCATTCTGGAGTCAGGGTGCTTACACTGTGCTTCGGCTGCACCGACACCACATTATTCAGCAGTAACAAAACCGGAGCATTTGACAAAGAAACTGAAATGTTATTAGAAGACAGCATCGGAACATTACCCATGCAGAAACCTGATTCCGCCGTCAAAGGCTTGTTAGATGCGTACAGAGACGGTAAGAGTGGTAGTACCTGGTTGATCACAGCCGACAAACCAGCAGAGGACATCACCGAAAACATTACAAAAGGATTCGAAATCATGAGCAGAGGTGTCTTCTGTTAA
Protein
MYDFKEKVVLVTGGAAGIGAGVVEAVLKEGAKHIAALDVDSVNGKILEDELNDNYKGNKVKFYKCDVTSNDLETVYDNVIKEHKYIDVVVNCAGIMNDRPNVYLKEIAVNVTALITSSFKAYNLMRKDHGGKGGTIINISSIVGLFQASLLPVYAATKSAVLQFSTCLGMEPHYSHSGVRVLTLCFGCTDTTLFSSNKTGAFDKETEMLLEDSIGTLPMQKPDSAVKGLLDAYRDGKSGSTWLITADKPAEDITENITKGFEIMSRGVFC

Summary

Similarity
Belongs to the short-chain dehydrogenases/reductases (SDR) family.
EMBL
BABH01019210    KP237895    AKD01748.1    KZ149998    PZC75361.1    KF960797    + More
AII21999.1    RSAL01000003    RVE54802.1    KQ459302    KPJ01719.1    KQ461175    KPJ07892.1    JTDY01007968    KOB64832.1    AGBW02011082    OWR47236.1    RVE54801.1    MG846919    AXY94771.1    KP899548    AKQ06147.1    BABH01019201    BABH01019202    BABH01019208    RVE54803.1    OWR47240.1    KPJ01716.1    KPJ07894.1    GEYN01000012    JAV02117.1    BABH01019209    OWR47239.1    AGBW02009904    OWR49599.1    OWR47238.1    ODYU01002522    SOQ40118.1    KC007341    AGQ45606.1    SOQ40119.1    JTDY01007982    KOB64820.1    SOQ40120.1    NWSH01001071    PCG72771.1    ODYU01011579    SOQ57407.1    JTDY01004799    KOB67739.1    ODYU01006680    SOQ48742.1    NWSH01000014    PCG80831.1    DQ512730    ABF59817.1    BABH01019219    PZC75359.1    KOB67737.1    KP899552    AKQ06151.1    KQ460366    KPJ15603.1    KQ459249    KPJ02346.1    KPJ02363.1    PCG80830.1    KPJ15584.1    KPJ01717.1    PCG72772.1    PCG72773.1    KPJ07893.1    KPJ15601.1    KPJ15602.1    KPJ02362.1    AY491503    AAR84629.1    KPJ15583.1    ODYU01010208    SOQ55170.1    KP899549    AKQ06148.1    AGBW02009651    OWR50237.1    KQ460779    KPJ12396.1    KPJ12400.1    OWR50236.1    KQ971354    EFA05875.1    GEYN01000013    JAV02116.1    GEZM01036109    GEZM01036108    JAV82969.1    ADTU01012731    DQ443276    ABF51365.1    BABH01027538    ODYU01003911    SOQ43254.1    KP237897    AKD01750.1    AK401931    KQ459144    BAM18553.1    KPJ03685.1    KZ149989    PZC75626.1    JTDY01007189    KOB65394.1    GL887491    EGI71071.1    KQ979609    KYN20169.1    KQ982944    KYQ48859.1    KQ976625    KYM79033.1    KP899550    AKQ06149.1    SOQ43256.1    KC007343    AGQ45608.1    KQ982585    KYQ54300.1    GL437252    EFN70745.1    NWSH01001322    PCG71699.1    KQ434870    KZC09506.1    KQ977642    KYN00938.1    KP237899    AKD01752.1    KQ981979    KYN31469.1    KQ976424    KYM88327.1    LN794625    CEO43692.1    EZ407131    ACX53694.1    LBMM01001364    KMQ96442.1    KP899551    AKQ06150.1    KK107200    QOIP01000002    EZA55494.1    RLU25832.1   
Pfam
PF00106   adh_short        + More
PF10545   MADF_DNA_bdg
Interpro
IPR002347   SDR_fam        + More
IPR020904   Sc_DH/Rdtase_CS       
IPR036291   NAD(P)-bd_dom_sf       
IPR006578   MADF-dom       
SUPFAM
SSF51735   SSF51735       
PDB
5ILO     E-value=3.08286e-24,     Score=275

Ontologies

Topology

Length:
270
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
13.24683
Exp number, first 60 AAs:
4.31542
Total prob of N-in:
0.33571
outside
1  -  270
 
 

Population Genetic Test Statistics

Pi
205.214969
Theta
141.80002
Tajima's D
0.997174
CLR
0.111269
CSRT
0.662716864156792
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号