SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO05839
Pre Gene Modal
BGIBMGA001404
Annotation
PREDICTED:_RNA-directed_DNA_polymerase_from_mobile_element_jockey-like_[Bombyx_mori]
Location in the cell
Extracellular   Reliability : 1.887
 

Sequence

CDS
ATGTATAAACTACTTGAGCGAATCACACTTAACCGCATTGCACCAACTATAGAAAAACATATTCCTCAAGAGCAAGCTGGATTCCGTCCAGGACGCAGCTGCAGCGATCAAGTGTTAGCACTGACCACACTCTTGGAGAGGGGATTTAATGAAAACCTCAAGTCGTCAACTGTATTCGTGGACCTAACCGCTGCTTACGACACAGTATGGCGCCAGGGACTGCTGTACAAACTACTCAAGCTGATCCCCTGTATAAAGATCTACAAAGTTATTGAGGACGCTTTTACCAACAGACCATTCCGTGTCTATCTGGGAGACAAGTCTAGCTTATCCAGGGTCCTGAACAACGGTCTCCCGCAGGGCTCAGTCCTCGCACCAACACTCTTCAACGTGTACACCCACGATGTGCCAGAGATGCTCTCCAGGAAATTTCCGTACGCCGACGATCTAGCTCTAGTCGCACAAGGCCGCAGTATAGAGACAACGGAATGTCAGCTTGAAAACGACATGGCCACGCTTGATGACTACTTCATTCGATGGCGCTTGTGTCCAAACGCTTCCAAGACGGAAGTCTGCTGTTTCCACCTAAATAACCGACAGGCTAACAAGAAACCCAACGTCACCTTTAGAGGTTCCACTCTCCCCTTTAACCCCTATCCCAAATATCTGAGTGTCACCCTAGACCTGGTTTCAGAGAAAAACGCCCAATCTGGTGCATGCTTAACCACCTGA
Protein
MYKLLERITLNRIAPTIEKHIPQEQAGFRPGRSCSDQVLALTTLLERGFNENLKSSTVFVDLTAAYDTVWRQGLLYKLLKLIPCIKIYKVIEDAFTNRPFRVYLGDKSSLSRVLNNGLPQGSVLAPTLFNVYTHDVPEMLSRKFPYADDLALVAQGRSIETTECQLENDMATLDDYFIRWRLCPNASKTEVCCFHLNNRQANKKPNVTFRGSTLPFNPYPKYLSVTLDLVSEKNAQSGACLTT

Summary

EMBL
GGMS01015939    MBY85142.1    BABH01040680    GGMS01017393    MBY86596.1    GGMS01014914    + More
MBY84117.1    GG694201    EFA13393.1    QFNT01000080    PZO93396.1    GGMR01011027    GGMR01014159    MBY23646.1    MBY26778.1    GFXV01006156    MBW17961.1    ABLF02041704    GECZ01030418    JAS39351.1    GGMS01014285    MBY83488.1    ABLF02018295    ABLF02048731    ABLF02008383    ABLF02008387    ABLF02008388    ABLF02008389    ABLF02042376    ABLF02043653    GGMS01011579    MBY80782.1    ABLF02008152    ABLF02025872    ABLF02015153    ABLF02015154    GEBQ01031055    JAT08922.1    GEBQ01004298    JAT35679.1    ABLF02029964    AJVK01031149    ABLF02021396    GBHO01020646    JAG22958.1    ABLF02032924    ABLF02013865    ABLF02013866    ABLF02059691    GGMS01002779    MBY71982.1    ABLF02009760    NWSH01000896    PCG73650.1    GGMS01013298    MBY82501.1    GGMS01013279    MBY82482.1    ABLF02031655    KQ971325    EEZ99467.2    GGMR01017280    MBY29899.1    ABLF02030901    ABLF02059692    ABLF02033421    GGMR01011854    MBY24473.1    AAGJ04013553    GGMR01002645    MBY15264.1    ABLF02007187    ABLF02020407    ABLF02051791    ABLF02064862    AAGJ04063984    ABLF02014865    ABLF02025557    ABLF02067079    KZ149907    PZC78267.1    ABLF02007188    ABLF02035831    ABLF02035833    ABLF02057398    AAGJ04076310    PZQS01000003    PVD34672.1    ABLF02035448    GGMR01019198    MBY31817.1    LBMM01018951    KMQ83660.1    KZ150236    PZC71961.1    ABLF02066620    RQTK01001306    RUS70916.1    GBHO01016303    JAG27301.1    ABLF02016613    GAPW01000276    JAC13322.1    GGMS01004685    MBY73888.1    GBHO01014486    GBHO01014484    GBHO01012635    JAG29118.1    JAG29120.1    JAG30969.1    GEZM01008457    JAV94772.1    GFDL01000006    JAV35039.1    GFDL01000004    JAV35041.1    ABLF02008463    ABLF02029306    ABLF02029314    ABLF02060138    NWSH01007753    PCG62823.1    M95171    AAA29354.1    S59870    AAB26437.2    GGMR01000676    MBY13295.1    ABLF02030646    GDHC01020244    JAP98384.1    GBHO01008295    JAG35309.1    ABLF02008153    ABLF02008462    ABLF02008464    ABLF02008933    GGMS01012362    MBY81565.1    ABLF02003961    ABLF02059872    ABLF02036316    ABLF02036319    ABLF02048663    ABLF02066977    GBHO01014489    GBHO01012641    JAG29115.1    JAG30963.1    GALX01005359    JAB63107.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF00514   Arm
PF05699   Dimer_Tnp_hAT
PF02892   zf-BED
PF00075   RNase_H
PF03372   Exo_endo_phos
Interpro
IPR000477   RT_dom        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR005135   Endo/exonuclease/phosphatase       
IPR011989   ARM-like       
IPR000225   Armadillo       
IPR028435   Plakophilin/d_Catenin       
IPR028446   JAC-1       
IPR016024   ARM-type_fold       
IPR003656   Znf_BED       
IPR008906   HATC_C_dom       
IPR036236   Znf_C2H2_sf       
IPR011010   DNA_brk_join_enz       
IPR013762   Integrase-like_cat_sf       
IPR026630   EPM2A-int_1       
IPR012337   RNaseH-like_sf       
IPR036397   RNaseH_sf       
IPR002156   RNaseH_domain       
SUPFAM
SSF56219   SSF56219        + More
SSF48371   SSF48371       
SSF57667   SSF57667       
SSF56349   SSF56349       
SSF53098   SSF53098       
PDB
6AR3     E-value=6.49755e-05,     Score=108

Ontologies

Topology

Length:
243
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.01054
Exp number, first 60 AAs:
0.0005
Total prob of N-in:
0.03909
outside
1  -  243
 
 

Population Genetic Test Statistics

Pi
132.879621
Theta
54.374501
Tajima's D
1.11363
CLR
11.262216
CSRT
0.694115294235288
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号