SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO05762
Pre Gene Modal
BGIBMGA006801
Annotation
PREDICTED:_guanylate_cyclase_32E-like_[Bombyx_mori]
Full name
Guanylate cyclase       + More
Receptor-type guanylate cyclase Gyc76C      
Alternative Name
DrGC-1
Location in the cell
PlasmaMembrane   Reliability : 2.638
 

Sequence

CDS
ATGTGGCACGGTGCGCGGGTGTTGGTGTTCGCGGCGCTGGGCTTACTGGCTGGGCCTTCGCTTGCCCACAAGAAGTTCAATATCACCATTGGCTACTTACCGGCTCTTACCGGTGACTTGCGAGACAGACAAGGACTCACAGTCTCCGGGGCACTGTCGTTGGCACTTGAAGAGCTGAACAATGGAGTCGATCTGCTGCCGGATGTGGAGATTCACATGCAGTGGAACAACACGAAATATGACATGGTAACTTCCACCAGGCTCATCACCGAAATGAGTCGTGCAGGTGTAGTAGCCTTTTTCGGACCCGAAGGTCGCTGTGAAACTGAAGCCATAATTGCGCAATCCAGAAACTTGCCTATGATCTCTTACAAATGCTCAGACTACCAAGTATCTAGGCTACCAAACTTTGCTCGATTAGAGCCTCCGGGCGTTCAGGCGACAAAAGCGTTAATATCGTTGCTACGTTACTATAGATGGAACAAATTCTCTATATTGTATGAAGAATCTTGGATGACGGTAGCCCTGACGTTGGCGAACTATGCCAAGGATTTTAACATGACTGTAAACCATCAGAGTCCCGTCATAAATACTTTTAAATGTTGCGTAGAGAAAATGGCTTGCTGTGCACCCGGTTTCTGGTATCAGTTCATTCATGATACAAAAAACAAAACAAGAATTTACGTTTTCCTTGGGTCGACTTCGGGACTAATAGAGATGATGACCGCCATGGAGTCGCTGCAGTTATTCGCGAAGGGCGAGTACATGGTTATATTCGTGGACATGATGACGTACTCTCTTAAAGACTCTGCCAAGTATTTGTTGAAAATCGAAGATCGTTTATCGTCGACATTAATATGTCCGAACACGCCTGAATTTAAAAAGAGAGCCCAGTCGTTACTGGTGATAGCTTCGTCGGAACCATCCCCGGAATATGAAGAGTTTACGGCTAAAGTCAGGAAATACAATTCTCTAGAACCATTCAATTTTCCCGATGTCTTTGGCAGCAAGTACATTAAGTTTGTATCCATTTACGCTGCGTACTTGTATGATTCGGTGAAGCTCTATGCTAAAGCTCTAGATGAAATAATCAAGGAGGAAACTCAAAAGGAGCCCTTGACGCAGGCCAAGCTAACGAATATTGTCACTAACGGAACAGCCATTGTGGCGAAGATGATTAAAAGTTCGCCATACAAAAGTGTGTCCGGTTTGACGATACGTTTAGATGATCGTGGCGATTCCGAGGGAAACTTCTCCTTGCTCGCTTTCAAGCCGATCAACAACAAGATTGATAGAAACTGCAGTTACAGTATGATACCGGTTGCTCATTTCCAGCAAAACAGTAAAGAGTTTCCTGATTACAAACTGAATTCTCGTATACCGATCGATTGGCCTGACAGCGTGAAACCGGAGGACGAACCGTCTTGCGGTTTCAACAACGAGAAATGTCCAAGGCACAACTCGCTGATAACGTTGGCGTTACCGTTAGCGTTGACGGGAACGTTGGCGGTGACTTTGTTTTGTGTGTTATTCGTCACGGTCAGCAAATACCGAAAATGGAAGATCAAACAAGAAATAGAAGGTTTTCTTTGGGAAATAGACGCACAGGAAGTTACCGGATATTCCGACAACGGCCTCGTGTGCTCGCCCAGTAAGTTATGTCTAGCGAGCGGTATATCATACGAAATGTGCCCACAAAAATTCACCACGACGGCGCAATACAGAGGGAATTTAGTCAGGATAAAAACATTGAAGTTTTCTAAAAAGAAGGATATATCTCGGGACATAATGAAAGAGATGCGGCTGCTGCGCGAGCTGCGTCACGACAATCTCAACTCGTTCATCGGCGCCGTCGTGGAGCCGATGCGCGTGCTCATCCTCACCGACTACTGTGCCAAGGGGAGCTTGTATGATATAATAGAAAACGAAGATATCAAATTGGATCAGATGTTAATATCTTTGCTTATTCACGATCTCATTAAGGGTATGATCTTCATTCATTCATCGCCTTTAATATTTCACGGAAATCTCAAATCCTCGAATTGTGTAGTTACATCAAGATGGATGTTACAAGTAGCTGATTTTGATCTTCGTGAGCTGAAATATTGCGCTGAAAACAAGTTTATTGGAGAACATCAGTATTATAGAGGTTTGCTTTGGAAATCACCAGAGTTGTTGAGAGGATTAAACAACCCGAATGGCATCGTGGGCGGAACGCAAAAAGGTGACGTCTATGCGTTTGGGATTATTCTATACGAAGTGATAGCGAGAAAAGGCCCTTTCGGAAATGTCGCAATGGAGCCCAAAGATATAATAGACCGCTTGAAGCGGCCGAAGTTGGACGGCGAAGAGTTGTTTCGTCCGGACACGAGCAGCATCGACGGCGGCATCGACGACTACATCGTGTCGTGCATGAAGGACTGCTGGGCAGAAGATCCCAACACAAGACCTGACTTCCCTACGATTAGAACCAGACTAAAGAAGATGAAATCGGTACAGTAA
Protein
MWHGARVLVFAALGLLAGPSLAHKKFNITIGYLPALTGDLRDRQGLTVSGALSLALEELNNGVDLLPDVEIHMQWNNTKYDMVTSTRLITEMSRAGVVAFFGPEGRCETEAIIAQSRNLPMISYKCSDYQVSRLPNFARLEPPGVQATKALISLLRYYRWNKFSILYEESWMTVALTLANYAKDFNMTVNHQSPVINTFKCCVEKMACCAPGFWYQFIHDTKNKTRIYVFLGSTSGLIEMMTAMESLQLFAKGEYMVIFVDMMTYSLKDSAKYLLKIEDRLSSTLICPNTPEFKKRAQSLLVIASSEPSPEYEEFTAKVRKYNSLEPFNFPDVFGSKYIKFVSIYAAYLYDSVKLYAKALDEIIKEETQKEPLTQAKLTNIVTNGTAIVAKMIKSSPYKSVSGLTIRLDDRGDSEGNFSLLAFKPINNKIDRNCSYSMIPVAHFQQNSKEFPDYKLNSRIPIDWPDSVKPEDEPSCGFNNEKCPRHNSLITLALPLALTGTLAVTLFCVLFVTVSKYRKWKIKQEIEGFLWEIDAQEVTGYSDNGLVCSPSKLCLASGISYEMCPQKFTTTAQYRGNLVRIKTLKFSKKKDISRDIMKEMRLLRELRHDNLNSFIGAVVEPMRVLILTDYCAKGSLYDIIENEDIKLDQMLISLLIHDLIKGMIFIHSSPLIFHGNLKSSNCVVTSRWMLQVADFDLRELKYCAENKFIGEHQYYRGLLWKSPELLRGLNNPNGIVGGTQKGDVYAFGIILYEVIARKGPFGNVAMEPKDIIDRLKRPKLDGEELFRPDTSSIDGGIDDYIVSCMKDCWAEDPNTRPDFPTIRTRLKKMKSVQ

Summary

Description
Guanylate cyclase involved in the production of the second messenger cGMP (PubMed:24284209). Acts as a receptor for the NPLP1-4 peptide and modulates the innate immune IMD pathway in response to salt stress by inducing nuclear translocation of NF-kappa-B protein Rel which leads to increased expression of the antimicrobial peptide diptericin (PubMed:21893139). Plays a role in Sema-1a-mediated axon repulsion which is required for the correct establishment of neuromuscular connectivity (PubMed:15282266, PubMed:24284209). Required in developing embryonic somatic muscle for correct patterning of ventral and lateral muscles and for localization of integrin beta-ps at developing dorsal muscle myotendinous junctions (PubMed:23213443). Required for invagination, migration and lumen shape of the embryonic salivary gland by regulating the localization of the integrin-binding protein rhea/Talin to the visceral mesoderm surrounding the gland and maintaining the laminin matrix (PubMed:23862019). Required in the developing wing to regulate extracellular matrix (ECM) organization by activating the cGMP-dependent protein kinase For which represses the activity of matrix metalloproteases such as Mmp2 and decreases ECM matrix reorganization (PubMed:26440503).
Catalytic Activity
GTP = 3',5'-cyclic GMP + diphosphate
Subunit
Interacts with the semaphorin 1A receptor PlexA; PlexA enhances Gyc76C catalytic activity. Interacts with the PDZ domain-containing protein kermit; kermit increases cell surface expression of Gyc76C.
Similarity
Belongs to the adenylyl cyclase class-4/guanylyl cyclase family.
Keywords
ATP-binding   Cell membrane   cGMP biosynthesis   Complete proteome   Glycoprotein   GTP-binding   Lyase   Magnesium   Membrane   Metal-binding   Nucleotide-binding   Receptor   Reference proteome   Signal   Transmembrane   Transmembrane helix  
Feature
chain  Guanylate cyclase
EC Number
4.6.1.2
EMBL
BABH01030967    BABH01030968    BABH01030969    BABH01030970    BABH01030971    BABH01030972    + More
RSAL01000275    RVE43120.1    ODYU01009272    SOQ53570.1    KQ460398    KPJ15013.1    NWSH01003611    PCG66059.1    KZ149900    PZC78585.1    KQ459302    KPJ01808.1    AGBW02010077    OWR49210.1    GAIX01004724    JAA87836.1    GFDF01007498    JAV06586.1    GFDF01007496    JAV06588.1    GFDF01007499    JAV06585.1    GFDF01007497    JAV06587.1    GFDF01007500    JAV06584.1    GFDF01007501    JAV06583.1    KQ971372    EFA10586.2    DS235068    EEB11232.1    JRES01000760    KNC28587.1    KA645835    AFP60464.1    GAMC01020881    GAMC01020880    GAMC01020878    JAB85677.1    GEZM01043506    JAV79046.1    GAKP01019888    GAKP01019887    JAC39064.1    CVRI01000055    CRL01142.1    CH477506    EAT39830.1    JXUM01036120    JXUM01036121    JXUM01036122    JXUM01036123    JXUM01036124    JXUM01036125    JXUM01036126    JXUM01036127    KQ561084    KXJ79765.1    JXJN01026843    GBXI01015827    GBXI01008764    GBXI01005765    JAC98464.1    JAD05528.1    JAD08527.1    GBXI01010499    JAD03793.1    ATLV01022307    ATLV01022308    KE525331    KFB47431.1    CCAG010012768    CH964095    EDW79232.1    AJWK01029883    AJWK01029884    AJWK01029885    AJWK01029886    AJWK01029887    AJWK01029888    AJWK01029889    AAAB01008986    EAA00176.4    APCN01003270    CP012525    ALC45096.1    CH379070    EDY74228.1    CH940647    EDW70469.1    OUUW01000002    SPP77407.1    AXCN02001683    CH933809    EDW18731.1    GGFM01001015    MBW21766.1    AE014296    AAF49117.1    AAV50029.1    L35598    U23485    BT011062    AAA74408.1    AAA85858.1    AAR31133.1    CH902618    EDV40842.1    CM000363    CM002912    EDX11116.1    KMZ00596.1    CH954178    EDV52405.1    GGFK01002303    MBW35624.1    GGFK01002283    MBW35604.1    CM000159    EDW95285.1    GGFK01002453    MBW35774.1    CH916366    EDV97369.1    GGFL01001032    MBW65210.1    GGFL01001598    MBW65776.1    GGFL01001700    MBW65878.1    KQ414582    KOC70843.1    QOIP01000010    RLU18186.1    KQ982498    KYQ55696.1    ADTU01017581    ADTU01017582    ADTU01017583    ADTU01017584    ADTU01017585    ADTU01017586    ADTU01017587    KQ981427    KYN41775.1    UFQT01000216    SSX21841.1    KK853196    KDR09972.1    CH480844    EDW49820.1    GEDC01007580    GEDC01000969    JAS29718.1    JAS36329.1    GEBQ01016200    GEBQ01014835    GEBQ01003621    JAT23777.1    JAT25142.1    JAT36356.1    GECZ01025815    GECZ01004426    JAS43954.1    JAS65343.1    KB631805    ERL86282.1    APGK01029504    APGK01029505    APGK01029506    KB740735    ENN79171.1    GFXV01002712    MBW14517.1    ABLF02031542    ABLF02031545    ABLF02043285    GFTR01008655    JAW07771.1    GGMS01015560    MBY84763.1    GBBI01002797    JAC15915.1    PYGN01000278    PSN49479.1    KQ435922    KOX68415.1    DS232069    EDS33793.1    GL769162    EFZ10727.1    KQ976453    KYM85379.1    KQ977255    KYN04643.1    ACPB03019543    KK107167    EZA56309.1   
Pfam
PF07714   Pkinase_Tyr        + More
PF01094   ANF_receptor
PF00211   Guanylate_cyc
PF07701   HNOBA
Interpro
IPR011009   Kinase-like_dom_sf        + More
IPR001828   ANF_lig-bd_rcpt       
IPR001245   Ser-Thr/Tyr_kinase_cat_dom       
IPR000719   Prot_kinase_dom       
IPR028082   Peripla_BP_I       
IPR029787   Nucleotide_cyclase       
IPR001054   A/G_cyclase       
IPR018297   A/G_cyclase_CS       
IPR011645   HNOB_dom_associated       
SUPFAM
SSF53822   SSF53822        + More
SSF56112   SSF56112       
SSF55073   SSF55073       
Gene 3D
PDB
3P86     E-value=1.03098e-25,     Score=293

Ontologies

Topology

Subcellular location
Cell membrane  
SignalP
Position:   1 - 22,         Likelihood:  0.983461
 
 
Length:
833
Number of predicted TMHs:
1
Exp number of AAs in TMHs:
32.50022
Exp number, first 60 AAs:
6.07606
Total prob of N-in:
0.27728
outside
1  -  491
TMhelix
492  -  514
inside
515  -  833
 
 

Population Genetic Test Statistics

Pi
195.171459
Theta
150.870816
Tajima's D
1.156291
CLR
0.589927
CSRT
0.702364881755912
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号