Gene

KWMTBOMO05715

Pre Gene Modal

BGIBMGA006822

Annotation

PREDICTED:_lys-63-specific_deubiquitinase_BRCC36-like_isoform_X1_[Amyelois_transitella]

Location

Bomo_Chr10(-):8667895-8672545      View in EpiBrowser

Full name

Lys-63-specific deubiquitinase BRCC36-like       + More
Lys-63-specific deubiquitinase BRCC36      

Alternative Name

BRCA1-A complex subunit BRCC36
BRCA1/BRCA2-containing complex subunit 3
BRCA1/BRCA2-containing complex subunit 36
BRISC complex subunit BRCC36

Location in the cell

Nuclear   Reliability : 1.906

CDS

ATGCTACAAAAGGTCCGTTTATCGTCTGATGTTGCTTTGGTCTGTATGCAACATGCGTTGTCGACAGAGAAAGAAGAAATCATGGGCTTACTTATAGGCGAGGTTCATGATAATGGTGCACTTGTTTCAATAGTGTCATCAGTAATACTTCGCCGTTTGGATAAAAAACCTGACCGTGTTGAAATATCAGAAGAACAACTGGTTCAAGCAACTGTTAGAGCTGAAGAATTAGCTGCAGAAGTTGGCCAACCTCTTAGAGTTGTTGGATGGTACCATTCGCATCCTCATATAACAGTGTGGCCATCCCATGTTGATTTGGCTACTCAATCAATGTATCAAAGGATGGATGCTAGTTTTGTTGGAATTATTTTTGCAGTATTTCTTACAGACCAATCAACAAAGGCCCCTTCAGTTCAAATTACTTGTTTTCAATCAATTAATGAAGGAGCTAGTCAAAGTCGGATTGAAATAGAAATGGAAATTGTAACTAACACTGATTCTTTGTTAACAAACAATTTCGAGACACTAACTCAGCTTCCAACAATTTTAAAAGAGGAAGAAGATGAAGCCTTTAATAATGAAATTAGTTATGATGATACTGATGACATTGTCACTAAGCAACATAATGCTGCAGTAAGGACTATTGCTATTGGCCACATTGTTGATAAGATGTCCCGACCAATGCTAGAAGGTTTAGTGGCCAGAAATTTATTAAACAGTATACGCTTAAAAGCATTGAAGAAACAGCATCAGCAGATGATGTCTAAATTAGAAAATATGACATGCTTGACCTAA

Protein

MLQKVRLSSDVALVCMQHALSTEKEEIMGLLIGEVHDNGALVSIVSSVILRRLDKKPDRVEISEEQLVQATVRAEELAAEVGQPLRVVGWYHSHPHITVWPSHVDLATQSMYQRMDASFVGIIFAVFLTDQSTKAPSVQITCFQSINEGASQSRIEIEMEIVTNTDSLLTNNFETLTQLPTILKEEEDEAFNNEISYDDTDDIVTKQHNAAVRTIAIGHIVDKMSRPMLEGLVARNLLNSIRLKALKKQHQQMMSKLENMTCLT

Description

Metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains.
Metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains. Does not have activity toward 'Lys-48'-linked polyubiquitin chains. Component of the BRCA1-A complex, a complex that specifically recognizes 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the brca1-bard1 heterodimer to sites of DNA damage at double-strand breaks (DSBs). In the BRCA1-A complex, it specifically removes 'Lys-63'-linked ubiquitin on histones H2A and H2AX, antagonizing the rnf8-dependent ubiquitination at double-strand breaks (DSBs). Catalytic subunit of the BRISC complex, a multiprotein complex that specifically cleaves 'Lys-63'-linked ubiquitin in various substrates. Mediates the specific 'Lys-63'-specific deubiquitination associated with the COP9 signalosome complex (CSN), via the interaction of the BRISC complex with the CSN complex. The BRISC complex is required for normal mitotic spindle assembly and microtubule attachment to kinetochores via its role in deubiquitinating numa1. Plays a role in interferon signaling via its role in the deubiquitination of the interferon receptor ifnar1; deubiquitination increases ifnar1 activity by enhancing its stability and cell surface expression. Down-regulates the response to bacterial lipopolysaccharide (LPS) via its role in ifnar1 deubiquitination.
Metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains, leaving the last ubiquitin chain attached to its substrates. Catalytic subunit of the BRISC complex; does not have activity by itself, but needs to be associated into a heterotetramer with ABRAXAS2 for minimal in vitro activity (PubMed:26344097). Plays a role in regulating the onset of apoptosis via its role in modulating 'Lys-63'-linked ubiquitination of target proteins (By similarity). Required for normal mitotic spindle assembly and microtubule attachment to kinetochores via its role in deubiquitinating spindle assembly factors (By similarity).

Cofactor

Zn(2+)

Subunit

Component of the BRCA1-A complex, at least composed of brca1, bard1, uimc1/rap80, abraxas1, brcc3/brcc36, babam2 and babam1/nba1. In the BRCA1-A complex, interacts directly with ABRAXAS1 and babam2. Component of the BRISC complex, at least composed of ABRAXAS2, brcc3/brcc36, babam2 and babam1/nba1. Within the complex, interacts directly with abraxas2. Both the BRCA1-A complex and the BRISC complex bind polyubiquitin (By similarity).
Component of the BRISC complex, at least composed of ABRAXAS2, BRCC3/BRCC36, BABAM2 and BABAM1/NBA1. Within the complex, interacts directly with ABRAXAS2. The heterodimer with ABRAXAS2 assembles into a heterotetramer. The BRISC complex binds polyubiquitin.
Component of the BRCA1-A complex, at least composed of brca1, bard1, uimc1/rap80, abraxas1, brcc3/brcc36, babam2 and babam1/nba1. In the BRCA1-A complex, interacts directly with abraxas1 and babam2. Component of the BRISC complex, at least composed of abraxas2, brcc3/brcc36, babam2 and babam1/nba1. Within the complex, interacts directly with abraxas2. Both the BRCA1-A complex and the BRISC complex bind polyubiquitin (By similarity).

Similarity

Belongs to the peptidase M67A family. BRCC36 subfamily.

Keywords

Complete proteome   Hydrolase   Metal-binding   Metalloprotease   Protease   Reference proteome   Ubl conjugation pathway   Zinc   Cell cycle   Cell division   Chromatin regulator   Cytoplasm   Cytoskeleton   DNA damage   DNA repair   Mitosis   Nucleus   3D-structure   Coiled coil  

Feature

chain  Lys-63-specific deubiquitinase BRCC36-like

Uniprot

A0A2A4JWK8   A0A2H1W977   A0A212F6W2   S4PCT1   A0A3S2LVC6   H9JBC7   + More
A0A194RB77   A0A0L7LE60   A0A194PDN5   A0A2A4JWZ6   A0A2T7NCK8   V4BG98   K1R0R3   A0A2P8YAA1   A0A2Z5TRJ1   V5IIZ7   A0A067QVS0   A0A2C9JF56   A0A210Q288   J3JYU2   K7IXJ9   A0A232EU46   N6ULW8   A0A293MEP4   A0A2A3E4J7   H3B4B8   A0A088A6H9   A0A151P8N4   A0A1U7RSM1   U3KAZ1   E1C8A6   A0A3B3S5D8   A0A1V4KYT2   A0A1W4WE61   R7U6V1   A0A218ULT7   V9KKD3   G3WEK8   A0A131XF68   A7SM50   A0A1W7RJ19   A0A3B1JQJ3   L7LX65   A0A3B4EJ64   H9G3Q5   A0A1W5A3I6   C3YJQ0   A0A2G8LBW4   A0A023GHH5   Q7M757   W5U945   A0A1L8F6Q4   Q66GV6   A0A224YTE2   A0A158NP23   A0A131YRF4   A0A195BXN5   A0A0R4IER2   A0A0M3KL72   A0A1S3RI09   W4YQI3   E2AXC7   A0A026W0T1   A0A1S2X2R6   B5X8M4   A0A0L7R8R7   A0A3Q1MRN1   Q4VA72   W5N8N8   F4WGK0   A0A195F0Z0   G3Q168   A0A151XDS1   A0A2U9CGR9   A0A3Q3M5N8   A0A0B8RYD9   J3SE22   T1E6E6   A0A098M1J7   U3EU66   A0A195DWS2   Q4SEG4   H3CY97   I3KZ08   A0A1W3JPW0   H2S9G6   A0A3B3ZNQ4   E9IEC0   A0A3P8YE19   A0A3Q3N217   A0A3B3ZMV5   A0A3B4ZYJ1   G3TUL5   A0A3Q1AK21   A0A3P8TRF8   A0A1S3GPJ2   A0A087YRW0   A0A0S7I0I1   H9H8T2  

EC Number

3.4.19.-

Pubmed

22118469    23622113    19121390    26354079    26227816    23254933    + More
22992520    29403074    26760975    25765539    24845553    15562597    28812685    22516182    20075255    28648823    23537049    9215903    22293439    15592404    29240929    24402279    21709235    28049606    17615350    26358130    25329095    25576852    21881562    18563158    29023486    15489334    16141072    12838346    23127152    27762356    28797301    21347285    26830274    23594743    26344097    20798317    24508170    30249741    20433749    19393038    21719571    25476704    23025625    23758969    25727380    23915248    15496914    25186727    21551351    25463417    21282665    25069045    17495919   

EMBL

NWSH01000473    PCG76166.1    ODYU01007140    SOQ49655.1    AGBW02009960    OWR49486.1    + More
GAIX01003996    JAA88564.1    RSAL01000172    RVE45138.1    BABH01030887    BABH01030888    KQ460398    KPJ15078.1    JTDY01001517    KOB73675.1    KQ459606    KPI91461.1    PCG76164.1    PZQS01000014    PVD18887.1    KB199651    ESP04837.1    JH817038    EKC34695.1    PYGN01000758    PSN41186.1    FX985822    BBA93709.1    GANP01002317    JAB82151.1    KK852954    KDR13285.1    NEDP02005212    OWF42851.1    BT128423    AEE63380.1    AAZX01004642    NNAY01002185    OXU21854.1    APGK01018457    KB740076    ENN81646.1    GFWV01013910    MAA38639.1    KZ288405    PBC26186.1    AFYH01058937    AFYH01058938    AFYH01058939    AFYH01058940    AKHW03000635    KYO45095.1    AGTO01010937    AC172026    LSYS01001150    OPJ89585.1    AMQN01010051    KB306898    ELT99386.1    MUZQ01000241    OWK54322.1    JW865884    AFO98401.1    AEFK01176309    GEFH01003813    JAP64768.1    DS469705    EDO35207.1    GDAY02000284    JAV51129.1    GACK01008852    JAA56182.1    AAWZ02029747    GG666520    EEN59357.1    MRZV01000133    PIK57741.1    GBBM01002002    JAC33416.1    BC120506    BC120508    AK134982    BN000130    JT408378    JT415653    AHH38325.1    CM004480    OCT67266.1    BC082208    GFPF01006387    MAA17533.1    ADTU01022128    GEDV01007871    JAP80686.1    KQ976394    KYM93352.1    CU539056    CU855912    AAGJ04049580    AAGJ04049581    GL443548    EFN61907.1    KK107536    QOIP01000008    EZA49191.1    RLU19806.1    BT047393    KQ414632    KOC67223.1    CR760965    BC096514    AHAT01007363    GL888137    EGI66665.1    KQ981891    KYN33822.1    KQ982268    KYQ58503.1    CP026258    AWP14906.1    GBSH01000432    JAG68592.1    JU173990    GBEX01000397    AFJ49516.1    JAI14163.1    GAAZ01000295    GBKC01000407    GBKD01000273    JAA97648.1    JAG45663.1    JAG47345.1    GBSI01000353    GBSI01000351    JAC96142.1    JAC96144.1    GAEP01000213    GBEW01000143    JAB54608.1    JAI10222.1    KQ980167    KYN17338.1    CAAE01014621    CAG00968.1    AERX01004656    GL762576    EFZ21081.1    AYCK01025600    GBYX01435653    JAO45682.1   

Proteomes

UP000218220    UP000007151    UP000283053    UP000005204    UP000053240    UP000037510    + More
UP000053268    UP000245119    UP000030746    UP000005408    UP000245037    UP000027135    UP000076420    UP000242188    UP000002358    UP000215335    UP000019118    UP000242457    UP000008672    UP000005203    UP000050525    UP000189705    UP000016665    UP000000539    UP000261540    UP000190648    UP000192223    UP000014760    UP000197619    UP000007648    UP000001593    UP000018467    UP000261440    UP000001646    UP000192224    UP000001554    UP000230750    UP000000589    UP000221080    UP000186698    UP000005205    UP000078540    UP000000437    UP000087266    UP000007110    UP000000311    UP000053097    UP000279307    UP000053825    UP000009136    UP000008143    UP000018468    UP000007755    UP000078541    UP000007635    UP000075809    UP000246464    UP000261660    UP000078492    UP000007303    UP000005207    UP000005226    UP000261520    UP000265140    UP000261640    UP000261400    UP000007646    UP000257160    UP000265080    UP000081671    UP000028760    UP000002280   

PRIDE

H9JBC7    L7LX65    Q7M757   

Pfam

PF01398   JAB        + More
PF18110   BRCC36_C

Interpro

IPR040749   BRCC36_C        + More
IPR000555   JAMM/MPN+_dom       
IPR037518   MPN       
IPR033860   MPN_BRCC36       

CDD

cd08068  MPN_BRCC36

ProteinModelPortal

A0A2A4JWK8   A0A2H1W977   A0A212F6W2   S4PCT1   A0A3S2LVC6   H9JBC7   + More
A0A194RB77   A0A0L7LE60   A0A194PDN5   A0A2A4JWZ6   A0A2T7NCK8   V4BG98   K1R0R3   A0A2P8YAA1   A0A2Z5TRJ1   V5IIZ7   A0A067QVS0   A0A2C9JF56   A0A210Q288   J3JYU2   K7IXJ9   A0A232EU46   N6ULW8   A0A293MEP4   A0A2A3E4J7   H3B4B8   A0A088A6H9   A0A151P8N4   A0A1U7RSM1   U3KAZ1   E1C8A6   A0A3B3S5D8   A0A1V4KYT2   A0A1W4WE61   R7U6V1   A0A218ULT7   V9KKD3   G3WEK8   A0A131XF68   A7SM50   A0A1W7RJ19   A0A3B1JQJ3   L7LX65   A0A3B4EJ64   H9G3Q5   A0A1W5A3I6   C3YJQ0   A0A2G8LBW4   A0A023GHH5   Q7M757   W5U945   A0A1L8F6Q4   Q66GV6   A0A224YTE2   A0A158NP23   A0A131YRF4   A0A195BXN5   A0A0R4IER2   A0A0M3KL72   A0A1S3RI09   W4YQI3   E2AXC7   A0A026W0T1   A0A1S2X2R6   B5X8M4   A0A0L7R8R7   A0A3Q1MRN1   Q4VA72   W5N8N8   F4WGK0   A0A195F0Z0   G3Q168   A0A151XDS1   A0A2U9CGR9   A0A3Q3M5N8   A0A0B8RYD9   J3SE22   T1E6E6   A0A098M1J7   U3EU66   A0A195DWS2   Q4SEG4   H3CY97   I3KZ08   A0A1W3JPW0   H2S9G6   A0A3B3ZNQ4   E9IEC0   A0A3P8YE19   A0A3Q3N217   A0A3B3ZMV5   A0A3B4ZYJ1   G3TUL5   A0A3Q1AK21   A0A3P8TRF8   A0A1S3GPJ2   A0A087YRW0   A0A0S7I0I1   H9H8T2  

PDB

5CW6     E-value=1.46813e-53,     Score=528

KEGG

101740582    K11864 BRCA1/BRCA2-containing complex subunit 3 [EC:3.4.19.-] | (RefSeq) lys-63-specific deubiquitin

PATHWAY

03440    Homologous recombination - Bombyx mori (domestic silkworm)

GO

GO:0070536   GO:0006281   GO:0070552   GO:0004843   GO:0070531   GO:0070537   GO:0000152   GO:0045739   GO:0072425   GO:0010165   GO:0031593   GO:0005737   GO:0006302   GO:0005654   GO:0030234   GO:0008237   GO:0036459   GO:0001525   GO:0005634   GO:0046872   GO:0010212   GO:0000922   GO:0051301   GO:0007049   GO:0016021   GO:0005515   GO:0003867   GO:0009448   GO:0019226   GO:0042065   GO:0042066   GO:0003707   GO:0043565  

Subcellular location

Nucleus   Localizes at sites of DNA damage at double-strand breaks (DSBs). Interaction with abraxas2 retains brcc3 in the cytoplasm.   With evidence from 2 publications.
Cytoplasm   Localizes at sites of DNA damage at double-strand breaks (DSBs). Interaction with abraxas2 retains brcc3 in the cytoplasm.   With evidence from 2 publications.
Cytoskeleton   Localizes at sites of DNA damage at double-strand breaks (DSBs). Interaction with abraxas2 retains brcc3 in the cytoplasm.   With evidence from 2 publications.
Spindle pole   Localizes at sites of DNA damage at double-strand breaks (DSBs). Interaction with abraxas2 retains brcc3 in the cytoplasm.   With evidence from 2 publications.

Length:

264

Number of predicted TMHs:

0

Exp number of AAs in TMHs:

0.15321

Exp number, first 60 AAs:

0.08105

Total prob of N-in:

0.04976

outside

1  -  264

 

 

Pi

333.04527

Theta

212.310272

Tajima's D

1.661296

CLR

0.013715

CSRT

0.821258937053147

Interpretation

Uncertain