SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO05708
Annotation
PREDICTED:_uncharacterized_protein_LOC105842588_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 3.252
 

Sequence

CDS
ATGGACGATGACGACAGGGGTGAGGGCTTCAGCTCCGCCCCTGTGTCCGCTCCCAAAATAATGGGAAAACGAAGATTGACCTCATCTGAATACGACGAAAGCCGCAAAATAAAAATGACTTTCATTAAAAATAAGCGCGGTCTTTTTAAAGACCACCATGCTCTTTATGAAGACCTTACAAAAAAAGAATACCCAGTGCTTCTTCAGTCAAGCCTCTCGCAACCAAATAACAGAGTCCCAATGGATCTGTTAAGAATAAACAAATCTTTAAAAAATGTTCAAGGGGTACAGTATGTCAAAGCTGCTGGAAACTTTTTTGCTAAAGTTTACTTTGGCTGTGCTCGGGATGCCAACACTTTTTTATTAGATGTAAGCTTTATGGAGTTAAATAATTGGACAGCAAAAATACCTTACGATAGCATTGAGAGTCAAGGAATTATTCGAGCTCCTGTGGAATTAGATGAAGAATCTCTTTTAGTAAATTTAAAAGCTTCATGCACAATACTCGGAGTAAAAAGATTTTTCAAAAAACAAGAGAATGGAAGTGACAAGCCACTGCAAACTGTGCTGGTTACATTTTTGGCGTCTAGCCATCCTGATCACGTCACATACGAGCATATTTGGATGCCTGTTTCGGATTATATTAGACCTGTGTTACAGTGCTTCAAATGCTACAAATTCGGACATGGAAGTGGTGCCTGTAAAGCCACTCAAGTTTGCTCTATTTGTTCAGGCAATCATTTTTATAAGGAGTGCAGCACTCCCAACATCTTCAAGTGCTCCAACTGCAGTGGGCCACATTCTGCAGTTTCTTACTCTTGCTCAGTAAAGGCAGCCAAGGTTGCTGAAGTTAAAAATAAGATCATCGGCAAGCAAACATCATATGCAGCCATACTAAAGACTCCTGTTATTAAGAACCCCGTGACCTCTTCTGACATACCTATATCTGCGAAGACCCCTCAAGGTAGGGCTTTAATTTCAGACATTATCAATTCAGAAATTGTCATCAGAACCATTACAAAAACTTTAATAGAATTGTTAAAGAAAAAGGATTCTAAATCCCCTTCTGGACCTATATCTACTCAATTAATTAAAGAAATGCTAGTAACGAATTTTACATCATAA
Protein
MDDDDRGEGFSSAPVSAPKIMGKRRLTSSEYDESRKIKMTFIKNKRGLFKDHHALYEDLTKKEYPVLLQSSLSQPNNRVPMDLLRINKSLKNVQGVQYVKAAGNFFAKVYFGCARDANTFLLDVSFMELNNWTAKIPYDSIESQGIIRAPVELDEESLLVNLKASCTILGVKRFFKKQENGSDKPLQTVLVTFLASSHPDHVTYEHIWMPVSDYIRPVLQCFKCYKFGHGSGACKATQVCSICSGNHFYKECSTPNIFKCSNCSGPHSAVSYSCSVKAAKVAEVKNKIIGKQTSYAAILKTPVIKNPVTSSDIPISAKTPQGRALISDIINSEIVIRTITKTLIELLKKKDSKSPSGPISTQLIKEMLVTNFTS

Summary

Pfam
PF00075   RNase_H        + More
PF00078   RVT_1
PF14529   Exo_endo_phos_2
Interpro
IPR001878   Znf_CCHC        + More
IPR036875   Znf_CCHC_sf       
IPR005135   Endo/exonuclease/phosphatase       
IPR002156   RNaseH_domain       
IPR036397   RNaseH_sf       
IPR036691   Endo/exonu/phosph_ase_sf       
IPR000477   RT_dom       
IPR012337   RNaseH-like_sf       
SUPFAM
SSF57756   SSF57756        + More
SSF53098   SSF53098       
SSF56219   SSF56219       
Gene 3D

Ontologies

Topology

Length:
374
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00440999999999999
Exp number, first 60 AAs:
0
Total prob of N-in:
0.00752
outside
1  -  374
 
 

Population Genetic Test Statistics

Pi
322.512121
Theta
201.350466
Tajima's D
1.894142
CLR
0.059883
CSRT
0.864306784660767
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号