SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO05603
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.665 Nuclear   Reliability : 2.297
 

Sequence

CDS
ATGCAAGACCGTCGTAAGATCGACGCACTAGAAATGTGGTGTTGGAGACGTCTCCTCAGAATTCCGTGGACCGCGCACCGTACCAACATTTCGATCCTGAAAGAGCTCAACATCAAGGAGAGACTATCGTCAACAGTCCAATTACGAATCCTCAAATTCTTCGGGCACATCACTCGTAATGAGGACTCCATTGAGCGGTTGGTGGTGCAAGGGAAAGTCGAGGGCAAAAGATCTCGCGGACGATCTCCAACACGATGGACCGACCTCATAAAATCTGTTACTCACTCCAACATAAATGCTTGCTCTCACTCTGCGAAACATCGTGCCACATGGCGTCGCATCGCGAGAGCATCGGTATCGCAGGATCCGACTGATGCATGA
Protein
MQDRRKIDALEMWCWRRLLRIPWTAHRTNISILKELNIKERLSSTVQLRILKFFGHITRNEDSIERLVVQGKVEGKRSRGRSPTRWTDLIKSVTHSNINACSHSAKHRATWRRIARASVSQDPTDA

Summary

Cofactor
pyridoxal 5'-phosphate
EMBL
FJ265547    ADI61815.1    FJ265548    ADI61816.1    GAIX01008594    JAA83966.1    + More
FJ265552    ADI61820.1    FJ265560    ADI61828.1    RSAL01000289    RVE42931.1    ODYU01006805    SOQ48998.1    FJ265559    ADI61827.1    KZ150203    PZC72267.1    FJ265557    ADI61825.1    ODYU01001007    SOQ36619.1    FJ265546    ADI61814.1    ODYU01004401    SOQ44236.1    KQ459603    KPI92872.1    GU815090    ADF18553.1    ODYU01003523    SOQ42419.1    FJ265553    ADI61821.1    MRZV01000056    PIK60437.1    MRZV01000994    PIK41715.1    MRZV01000940    PIK42365.1    MRZV01001207    PIK39730.1    MRZV01001216    PIK39650.1    MRZV01000196    PIK55924.1    AAGJ04055194    MRZV01000378    PIK51329.1    MRZV01002322    PIK33998.1    HACG01049256    CEK96121.1    NCKU01012182    RWS00163.1    NCKU01008836    RWS01655.1    KZ150366    PZC71172.1    MRZV01000817    PIK43880.1    HACG01049248    HACG01049253    CEK96113.1    CEK96118.1    HACG01049251    HACG01049252    CEK96116.1    CEK96117.1    HACG01049244    HACG01049247    CEK96109.1    CEK96112.1    KL363256    KL367985    KFD50217.1    KFD59415.1    KL363266    KL367526    KFD49675.1    KFD66333.1    HACG01049254    CEK96119.1    AHAT01022938    NCKU01004395    RWS06003.1    HACG01049255    CEK96120.1    HACG01049245    CEK96110.1    HACG01049249    CEK96114.1    RQTK01000360    RUS81011.1    RQTK01000625    RUS76894.1    RQTK01000685    RUS76136.1    AJ132772    CAA10770.1    KQ422743    KOF74343.1    GGMR01005851    MBY18470.1    AAGJ04161766    KZ149985    PZC75696.1    BART01031562    GAH15691.1    KQ977522    KYN02133.1    AHAT01015286    AHAT01012943    HACG01049490    HACG01049491    CEK96355.1    CEK96356.1    AHAT01009145    HACG01049494    HACG01049495    CEK96359.1    CEK96360.1    ABLF02024992    ABLF02024994    ABLF02025002    ABLF02043975   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF05699   Dimer_Tnp_hAT
PF03221   HTH_Tnp_Tc5
PF04218   CENP-B_N
PF00282   Pyridoxal_deC
Interpro
IPR036691   Endo/exonu/phosph_ase_sf        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR000477   RT_dom       
IPR008906   HATC_C_dom       
IPR002138   Pept_C14_p10       
IPR006600   HTH_CenpB_DNA-bd_dom       
IPR007889   HTH_Psq       
IPR009057   Homeobox-like_sf       
IPR015424   PyrdxlP-dep_Trfase       
IPR015421   PyrdxlP-dep_Trfase_major       
IPR021115   Pyridoxal-P_BS       
IPR002129   PyrdxlP-dep_de-COase       
SUPFAM
SSF56219   SSF56219        + More
SSF46689   SSF46689       
SSF53383   SSF53383       
Gene 3D

Ontologies

Topology

Length:
126
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00038
Exp number, first 60 AAs:
0.00038
Total prob of N-in:
0.48459
outside
1  -  126
 
 

Population Genetic Test Statistics

Pi
135.387439
Theta
118.358575
Tajima's D
0.451646
CLR
0.307539
CSRT
0.501374931253437
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号