SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO05584
Annotation
NA
Location in the cell
Cytoplasmic   Reliability : 1.747 Nuclear   Reliability : 1.643
 

Sequence

CDS
ATGGCACTGGCTAGGGTGAATCCATCCGTCGATGAGGCGGGAGCGAGGTCAACCTCCATCTCCGAGTCAGAGTCGGAGGACGAGGAGGCGGGCGCAGGTGACCTACGAGCAGGTGTTTTGGAGGGCACGACGGAGGCTGTGGATGATCGCGCTGCTGGAACGGTGGCCACGGCGGACGACGCAGCAGTTTTACTCGCCAGTATAGGCGACGCGGGAACGGCAGGCACGACGGAGGCTGCGGTGCTCGATGCAGAAGCTTTGCACGCAGCTTTACCTGCTCACCTGCAACAGCTGCAAGAGAAGAAAGACAAGGAGAAAGAAAAAGAGAAGGAGAAGGAGAAAGAAAAAGATGGAACGGAAAAGAAACCCACTAACTAA
Protein
MALARVNPSVDEAGARSTSISESESEDEEAGAGDLRAGVLEGTTEAVDDRAAGTVATADDAAVLLASIGDAGTAGTTEAAVLDAEALHAALPAHLQQLQEKKDKEKEKEKEKEKEKDGTEKKPTN

Summary

Uniprot
ProteinModelPortal

Ontologies

GO

Topology

Length:
125
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00545
Exp number, first 60 AAs:
0.00031
Total prob of N-in:
0.16976
outside
1  -  125
 
 

Population Genetic Test Statistics

Pi
15.812943
Theta
164.846657
Tajima's D
1.495075
CLR
0
CSRT
0.788510574471276
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号