SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO05459
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Full name
Guanylate cyclase      
Location in the cell
Nuclear   Reliability : 2.277
 

Sequence

CDS
ATGGAGCAAATAATAGAAAAGTACAAGGAGTTCAACAGACCAATATATATAGGTTTTATCGATTACGCTAAGGCATTTGATACGATCTCACATGACGCCATCTGGGAGGCACTGGACAAATGTCAGGTCCACGACAAGTACAAAAATGTCTTGAAGAACATTTACGACAAGAGCACCAGTTGTGTGAAACTAGAGAACCGAGGACCTGAAATACCTATTCTAAGAGGAGTGAGACAAGGAGACCCGCTTTCCCCGAAGATCTTTATAGCAGTGCTGCATAACATTTTTGAGGAGCTGAAATGGAAAAACGAAGGCCTTAAAATATGTAACCAATACTTGAGTCACCTCAGATTTGCAGATGATATAGTCCTCTTAGCTGATAACAGTAGAAAACTAGAAAAAATGATAAACCAACTAAATGTACAAAGTAAAAGAGTAGGCCTATTAATGAATAAAGACAAAACAAAAGTAATGACAAACAGCGTCAAACATCCAATAAAACTTGAAGGAAAAACATTAGAATTCGTAAACAAATACATATATCTAGGAAAAGAAATATCATTTGAAGACAGAAGCGAAGAAGAAGAGGTACAACGTAGAATAAATATGAGTTGGAAAAAATATTGGTCACTCAAAGAGATAATGAAAGGAGACTATCCACTCCACCTGAAGAAAACAGTTATGGATACATGCATCTTACCAACTCTCACATATGGTTGCCAATCGTGGACTTTCAACACCACCATAAAAACAAAAATGGTTAATTGCCAGAAAGCGATGGAAAGAAGCATTCTAAAAATAAAAATAAAAGATAAAGTAAGAAGTGAATTTATACGAAAAAAGACAAAATTAATTGATGTCCTAAACTTCAGTAAAAGATTAAAGTGGCGATGGGCTGGCCACGTAGCACGCTACAGTGACAAACGATGGACAATTGAAGTGACAAAATGGAAAGGGCCTAATGGGAAAAGAAGGAAAGGACGACCTATGAAACGATGGAGTGATGATATCATAGTCACCGCTGGGAAGGAGTGGATGAGGCAGGCTGGGAACAGAGAAAATTGGATTAAGCTGGAGGAGGCCTATACCCAAATAGGGGTTCCTGTCGAGGAAAATTGA
Protein
MEQIIEKYKEFNRPIYIGFIDYAKAFDTISHDAIWEALDKCQVHDKYKNVLKNIYDKSTSCVKLENRGPEIPILRGVRQGDPLSPKIFIAVLHNIFEELKWKNEGLKICNQYLSHLRFADDIVLLADNSRKLEKMINQLNVQSKRVGLLMNKDKTKVMTNSVKHPIKLEGKTLEFVNKYIYLGKEISFEDRSEEEEVQRRINMSWKKYWSLKEIMKGDYPLHLKKTVMDTCILPTLTYGCQSWTFNTTIKTKMVNCQKAMERSILKIKIKDKVRSEFIRKKTKLIDVLNFSKRLKWRWAGHVARYSDKRWTIEVTKWKGPNGKRRKGRPMKRWSDDIIVTAGKEWMRQAGNRENWIKLEEAYTQIGVPVEEN

Summary

Catalytic Activity
GTP = 3',5'-cyclic GMP + diphosphate
EC Number
4.6.1.2
EMBL
FJ265562    ADI61830.1    KZ150317    PZC71439.1    FJ265563    ADI61831.1    + More
ODYU01008249    SOQ51673.1    ODYU01004982    SOQ45402.1    KZ150485    PZC70710.1    FJ265564    ADI61832.1    ODYU01004088    SOQ43598.1    KZ150108    PZC73382.1    FJ265550    ADI61818.1    FJ265542    ADI61810.1    RSAL01002362    RVE40503.1    FJ265549    ADI61817.1    FJ265551    ADI61819.1    FJ265561    ADI61829.1    EF113398    EF113401    ABO45231.1    EF113402    ABO45239.1    FJ265545    ADI61813.1    KZ149907    PZC78256.1    GBBI01004876    JAC13836.1    KZ149985    PZC75698.1    KZ150072    PZC74016.1    FJ265543    ADI61811.1    FJ265544    ADI61812.1    RSAL01002130    RVE40575.1    MRZV01002136    PIK34564.1    GBGD01000380    JAC88509.1    KZ149912    PZC78089.1    AAGJ04144474    GFTR01005437    JAW10989.1    GFAC01005640    JAT93548.1    JARK01001351    EYC23394.1    JARK01001370    EYC16151.1    JARK01001340    EYC31295.1    JARK01001677    EYB83167.1    EYB83168.1    EYC23395.1    JARK01001512    EYB94036.1    RSAL01000016    RVE53061.1    EF113399    EF113400    ABO45233.1    JARK01000173    EYC41342.1    JARK01000388    EYC37469.1    EYC16150.1    MRZV01000640    PIK46507.1    UZAG01000503    VDO08661.1    MRZV01000899    PIK42833.1    JARK01001655    EYB84321.1    JARK01001362    EYC18844.1    EYC18843.1    AAGJ04050748    JPKZ01003153    KHN73088.1    UYWY01019463    VDM37564.1    JARK01001462    EYB98997.1    JARK01001341    EYC30284.1    QFQQ01000179    PZR20596.1    JARK01000695    EYC35261.1    JARK01001543    EYB91354.1    EYB91355.1    JARK01001434    EYC02684.1    JARK01001396    EYC09581.1    JARK01000807    EYC34984.1    JARK01001518    EYB93419.1    GBBM01001358    JAC34060.1    JARK01001711    EYB81734.1    JARK01001700    JARK01001393    EYB82228.1    EYC10181.1    JARK01001730    EYB81048.1    JARK01001464    EYB98786.1    EYB91353.1    JARK01000347    EYC38051.1    JARK01001621    EYB86109.1    JARK01000460    EYC36749.1    EYC30828.1    JARK01001736    JARK01001379    JARK01001338    EYB80775.1    EYB98943.1    EYC13646.1    EYC33347.1    EYB91356.1    JARK01001626    EYB85833.1    JARK01001438    EYC02111.1    EYC16376.1    JARK01001353    EYC22263.1    JARK01000055    EYC44622.1    JARK01001354    EYC21942.1    EYC44623.1    GBGD01000453    JAC88436.1    EYC21941.1    GBBI01004877    JAC13835.1    CAVP010058791    CDL95187.1    GDKW01001596    JAI54999.1    JARK01001568    EYB89432.1    JARK01001500    JARK01001343    EYB95040.1    EYC28825.1    PDUG01000004    PIC36796.1    JARK01001513    EYB93986.1    JARK01001348    EYC25145.1    CAVP010058300    CDL94394.1    JARK01001424    EYC04315.1    JARK01001632    EYB85541.1    EYC04316.1    EYC04317.1    EYC04314.1   
Pfam
PF14529   Exo_endo_phos_2        + More
PF00078   RVT_1
PF01826   TIL
PF13855   LRR_8
PF10323   7TM_GPCR_Srv
PF03372   Exo_endo_phos
PF01094   ANF_receptor
PF07714   Pkinase_Tyr
PF00211   Guanylate_cyc
Interpro
IPR005135   Endo/exonuclease/phosphatase        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR000477   RT_dom       
IPR036084   Ser_inhib-like_sf       
IPR002919   TIL_dom       
IPR032675   LRR_dom_sf       
IPR001611   Leu-rich_rpt       
IPR003591   Leu-rich_rpt_typical-subtyp       
IPR019426   7TM_GPCR_serpentine_rcpt_Srv       
IPR001828   ANF_lig-bd_rcpt       
IPR001245   Ser-Thr/Tyr_kinase_cat_dom       
IPR011009   Kinase-like_dom_sf       
IPR001170   ANPR/GUC       
IPR001054   A/G_cyclase       
IPR028082   Peripla_BP_I       
IPR000719   Prot_kinase_dom       
IPR029787   Nucleotide_cyclase       
SUPFAM
SSF56219   SSF56219        + More
SSF57567   SSF57567       
SSF53822   SSF53822       
SSF55073   SSF55073       
SSF56112   SSF56112       
Gene 3D
PDB
6AR3     E-value=0.0123255,     Score=90

Ontologies

Topology

Length:
372
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.01539
Exp number, first 60 AAs:
0.00464
Total prob of N-in:
0.02641
outside
1  -  372
 
 

Population Genetic Test Statistics

Pi
27.359647
Theta
26.574281
Tajima's D
-0.31344
CLR
45.263132
CSRT
0.286585670716464
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号