SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO05434
Annotation
endonuclease_and_reverse_transcriptase-like_protein_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.219 Nuclear   Reliability : 1.115 PlasmaMembrane   Reliability : 1.041
 

Sequence

CDS
ATGTACATTTGCTTTTTGGATGGGCGGAGCATCACGGTCGTTGTAGACGGTGACTGTTCTGATACCATGACCATTAACGCTGGCGTTCCACAAGGTTCGGTGCTCTCCCCCACGCTTTTCATCCTGTATATCAATGACATGCTGTCTATTGATGGCATGCATTGCTATGCAGATGATAGCACGGGGGATGCGCGATATATCGGCCATCAGAGTCTCTCTCGGAGCGTGGTGCAAGAGAGACGATCAAAACTTGTGTCTGAAGTGGAGAACTCTCTGGGGCGAGTCTCCGAATGGGGTGAATTGAACTTGGTTCAATTCAACCCGATAAAGACACAAGTTTGCGCGTTCACTGCGAAGAAGGACCCCTTTGTCATGGCGCCGCAATTCCAAGGAGTATCCCTGCAACCTTCCGAGAGTATCGGGATACTTGGGGTCGACGTTTCGAGCGATGTCCAGTTTCGGAGTCATTTGGAAGGCAAAGCCAAGTTGGCGTCCAAAATGCTGGGAGTCCTCAACAGAGCGAAGCGGTGCTTCACGCCTGGACAAAGACTTTTGCTTTATAAAGCACAAGTCCGGCCTCGCATGGAGTACTGCTCCCATCTCTGGGCCGGGGCTCCCAAATACCAGCTTCTTCCATTTGACTCCATACAGAGGAGGGCCGTTCGGATTGTCGATAATCCCATTCTCTCGGATCGTTTGGAGCCTCTGGGTCTGCGGAGGGACTTCGGTTCCCTCTGTATTTTATACCGTATGTTCCATGGGGAGTGCTCTGAGGAATTGTTCGAGATGATACCAACATCTCGTTTTTACCATCGCACCGCCCGCCACCGGAGTAGAGTTCATCCATACTACCTGGAGCCACTGCGGTCATCCACAGTGCGTTTCCAGAGATCTTTTTTGCCACGTACCATCCGGCTATGGAATGAGCTCCCCTCCTCGGTGTTTCCCGAGCGCTATGACATGTCCTTCTTCAAACGAGGCTTGTGGAGAGTATTAAGCGGTAGGCAGCGGCTTGGCTCTGCCCCTGGCATTGCTGAAGTCCATGGGCGACGGTAA
Protein
MYICFLDGRSITVVVDGDCSDTMTINAGVPQGSVLSPTLFILYINDMLSIDGMHCYADDSTGDARYIGHQSLSRSVVQERRSKLVSEVENSLGRVSEWGELNLVQFNPIKTQVCAFTAKKDPFVMAPQFQGVSLQPSESIGILGVDVSSDVQFRSHLEGKAKLASKMLGVLNRAKRCFTPGQRLLLYKAQVRPRMEYCSHLWAGAPKYQLLPFDSIQRRAVRIVDNPILSDRLEPLGLRRDFGSLCILYRMFHGECSEELFEMIPTSRFYHRTARHRSRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSSVFPERYDMSFFKRGLWRVLSGRQRLGSAPGIAEVHGRR

Summary

EMBL
AY359886    AAQ57129.1    RSAL01002067    RVE40593.1    RSAL01000422    RVE41792.1    + More
RSAL01000002    RVE54942.1    RSAL01000090    RVE48098.1    RSAL01003136    RVE40332.1    RVE55041.1    RVE55094.1    ODYU01002162    SOQ39302.1    GDRN01105059    JAI57791.1    DPOC01000269    HCX22453.1    GFAC01000919    JAT98269.1    RSAL01000193    RVE44603.1    GEFM01002394    JAP73402.1    GEGO01001118    JAR94286.1    GDRN01111334    JAI56796.1    GFAC01005646    JAT93542.1    GFAA01002514    JAU00921.1    GEFM01006417    JAP69379.1    GDRN01111277    JAI56804.1    LSMT01000297    PFX20951.1    GEGO01002473    JAR92931.1    GEGO01004433    JAR90971.1    GEFM01002324    JAP73472.1    MRZV01000639    PIK46517.1    NSIT01000239    PJE78188.1    GFAA01002385    JAU01050.1    GEGO01004630    JAR90774.1    GFAC01005665    JAT93523.1    GEFM01005882    JAP69914.1    GBIH01002577    JAC92133.1    GEGO01003312    JAR92092.1    GFAA01002479    JAU00956.1    NSIT01000218    PJE78268.1    GEFM01002419    JAP73377.1    GEFM01006421    JAP69375.1    GEGO01003794    JAR91610.1    QRBI01000112    RMC10390.1    GFAA01002657    JAU00778.1    GEGO01007187    JAR88217.1    QRBI01000171    RMB96954.1    FLMD02000280    SCV66640.1    KZ505886    PKU43598.1    QRBI01000146    RMB99817.1    GEGO01003111    JAR92293.1    QRBI01000093    RMC21757.1    AAGJ04096877    AAGJ04088192    NSIT01000412    PJE77717.1    GEGO01004132    JAR91272.1    AAGJ04095885    RMC21953.1    GDRN01111278    JAI56803.1    GEGO01003427    JAR91977.1    GFAA01003161    JAU00274.1    QRBI01000116    RMC08860.1    FLMD02000154    SCV66010.1    NSIT01000538    PJE77518.1    NSIT01000477    PJE77602.1    AGCU01164164    AAGJ04090645    GEGO01003518    JAR91886.1    AGCU01055496    AGCU01148809    AGCU01081420    AAGJ04103823    AGCU01168427    QRBI01000131    RMC03475.1    GFAC01005670    JAT93518.1    AGCU01046616    AGCU01096477    AH011247    AAL40415.1    PSZC01000087    PPJ25136.1    AGCU01064953    AGCU01111641    AGCU01135984   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF01585   G-patch
PF04939   RRS1
PF00458   WHEP-TRS
Interpro
IPR000477   RT_dom        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR036691   Endo/exonu/phosph_ase_sf       
IPR012677   Nucleotide-bd_a/b_plait_sf       
IPR000504   RRM_dom       
IPR034653   SPF45_RRM       
IPR003954   RRM_dom_euk       
IPR000467   G_patch_dom       
IPR040052   RBM17       
IPR035979   RBD_domain_sf       
IPR007023   Ribosom_reg       
IPR000738   WHEP-TRS_dom       
IPR009068   S15_NS1_RNA-bd       
IPR019786   Zinc_finger_PHD-type_CS       
IPR011011   Znf_FYVE_PHD       
IPR019787   Znf_PHD-finger       
IPR013083   Znf_RING/FYVE/PHD       
SUPFAM
SSF56219   SSF56219        + More
SSF54928   SSF54928       
SSF47060   SSF47060       
SSF57903   SSF57903       
Gene 3D

Ontologies

Topology

Length:
351
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.17917
Exp number, first 60 AAs:
0.17917
Total prob of N-in:
0.01544
outside
1  -  351
 
 

Population Genetic Test Statistics

Pi
121.31231
Theta
107.772915
Tajima's D
0.394112
CLR
11.593771
CSRT
0.490675466226689
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号