Gene

KWMTBOMO05416

Pre Gene Modal

BGIBMGA006681

Annotation

Serine/threonine-protein_kinase_6_[Danaus_plexippus]

Location

Bomo_Chr10(+):1542131-1543233      View in EpiBrowser

Full name

Aurora kinase A-A       + More
Aurora kinase A-B      
Aurora kinase A      

Alternative Name

Aurora/IPL1-related kinase 1
Serine/threonine-protein kinase 6-A
Serine/threonine-protein kinase Eg2-A
Serine/threonine-protein kinase aurora-A
p46Eg265
Serine/threonine-protein kinase 6-B
Serine/threonine-protein kinase Eg2-B
p46XlEg22
Aurora 2
Aurora family kinase 1
Ipl1- and aurora-related kinase 1
Serine/threonine-protein kinase 6
Serine/threonine-protein kinase Ayk1

Location in the cell

Cytoplasmic   Reliability : 2.238

CDS

ATGCCTACGGACAGTTTCAAAATCCCAGCCGTACCGTCTTCTCGGCCTTTATGTTCAAAAGCAAACGCCAGTGACAACAAAGACCAGACTTCTTCAAGACTTGAATTGAAACGTGACGATAAAAAGAAGACTTGGTCACTATCGGACTTCGATCTAGGACGACCGCTCGGTAAAGGGAAATTCGGCAATGTGTACTTAGCCCGTGAAAAAGAATCTCACTATGTCGTCGCATTGAAGGTTCTTTTTAAAAGCCAAATCTTGGATTCAGAAATAGAGCACCAAGTACGCCGTGAAGTTGAAATCCAGTGTCGACTACGTCATCCGAACATCTTACGCATGTATGGATACTTTCACGATGAAAAACGAATTTATTTAATATTAGAATACGCGAAACATGGCGCCCTTTACAAATTACTGAAGGAACGCGGCCGATTTGATGAAAAAACCGCTGCAATTTACATTCGTGATTTGACGAAGGCCCTTATTTATTGTCATACCAAGAAAGTTATACATCGTGATATAAAACCGGAAAATTTATTGATTGGTCACAACTGGGAACTTAAAATTGCTGATTTTGGCTGGTCCGTCCACTCGCCCTCATCAAGACGGATGACATTGTGCGGAACATTAGATTACCTGTCACCAGAAATGATTGAAGGAAAACCCCATAATTATGCAGTAGATATTTGGAGTTTAGGGGTTTTGTGTTACGAACTGCTTGTTGGATTGCCACCATTTGATGCCAAGGACTCTCATCAAACCTACAGAAAAATTAGATATGTCATAATTAAATATCCCGAATATATTTCTGAAAAAGCCAAAGATTTAATGGGAAAACTTTTAGTTATCGAGCCTGAAGAGAGGTTGCCACTATCAAATGTCTTAAAACACCCGTGGATTATAGAGAATGCTCCTGAAGGTGCTCATCCACCATTAATGAATGCTGAGCAAAAATAA

Protein

MPTDSFKIPAVPSSRPLCSKANASDNKDQTSSRLELKRDDKKKTWSLSDFDLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRLRHPNILRMYGYFHDEKRIYLILEYAKHGALYKLLKERGRFDEKTAAIYIRDLTKALIYCHTKKVIHRDIKPENLLIGHNWELKIADFGWSVHSPSSRRMTLCGTLDYLSPEMIEGKPHNYAVDIWSLGVLCYELLVGLPPFDAKDSHQTYRKIRYVIIKYPEYISEKAKDLMGKLLVIEPEERLPLSNVLKHPWIIENAPEGAHPPLMNAEQK

Description

Mitotic serine/threonine kinases that contributes to the regulation of cell cycle progression. Associates with the centrosome and the spindle microtubules during mitosis and plays a critical role in various mitotic events including the establishment of mitotic spindle, centrosome duplication, centrosome separation as well as maturation, chromosomal alignment, spindle assembly checkpoint, and cytokinesis. Phosphorylates numerous target proteins. Important for microtubule formation and/or stabilization.
Mitotic serine/threonine kinases that contributes to the regulation of cell cycle progression. Associates with the centrosome and the spindle microtubules during mitosis and plays a critical role in various mitotic events including the establishment of mitotic spindle, centrosome duplication, centrosome separation as well as maturation, chromosomal alignment, spindle assembly checkpoint, and cytokinesis. Phosphorylates numerous target proteins. Important for microtubule formation and/or stabilization (By similarity).
Mitotic serine/threonine kinase that contributes to the regulation of cell cycle progression. Associates with the centrosome and the spindle microtubules during mitosis and plays a critical role in various mitotic events including the establishment of mitotic spindle, centrosome duplication, centrosome separation as well as maturation, chromosomal alignment, spindle assembly checkpoint, and cytokinesis. Required for normal spindle positioning during mitosis and for the localization of NUMA1 and DCTN1 to the cell cortex during metaphase (By similarity). Required for initial activation of CDK1 at centrosomes. Phosphorylates numerous target proteins, including ARHGEF2, BORA, BRCA1, CDC25B, DLGP5, HDAC6, KIF2A, LATS2, NDEL1, PARD3, PPP1R2, PLK1, RASSF1, TACC3, p53/TP53 and TPX2. Regulates KIF2A tubulin depolymerase activity. Required for normal axon formation. Plays a role in microtubule remodeling during neurite extension. Important for microtubule formation and/or stabilization. Also acts as a key regulatory component of the p53/TP53 pathway, and particularly the checkpoint-response pathways critical for oncogenic transformation of cells, by phosphorylating and stabilizing p53/TP53. Phosphorylates its own inhibitors, the protein phosphatase type 1 (PP1) isoforms, to inhibit their activity. Necessary for proper cilia disassembly prior to mitosis.
Mitotic serine/threonine kinase that contributes to the regulation of cell cycle progression. Associates with the centrosome and the spindle microtubules during mitosis and plays a critical role in various mitotic events including the establishment of mitotic spindle, centrosome duplication, centrosome separation as well as maturation, chromosomal alignment, spindle assembly checkpoint, and cytokinesis. Required for normal spindle positioning during mitosis and for the localization of NUMA1 and DCTN1 to the cell cortex during metaphase (By similarity). Required for initial activation of CDK1 at centrosomes. Phosphorylates numerous target proteins, including ARHGEF2, BORA, BRCA1, CDC25B, DLGP5, HDAC6, KIF2A, LATS2, NDEL1, PARD3, PPP1R2, PLK1, RASSF1, TACC3, p53/TP53 and TPX2. Regulates KIF2A tubulin depolymerase activity. Required for normal axon formation. Plays a role in microtubule remodeling during neurite extension. Important for microtubule formation and/or stabilization. Also acts as a key regulatory component of the p53/TP53 pathway, and particularly the checkpoint-response pathways critical for oncogenic transformation of cells, by phosphorylating and stabilizating p53/TP53. Phosphorylates its own inhibitors, the protein phosphatase type 1 (PP1) isoforms, to inhibit their activity (By similarity). Necessary for proper cilia disassembly prior to mitosis (By similarity). Interacts with SIRT2 (By similarity).

Catalytic Activity

ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]
ATP + L-threonyl-[protein] = ADP + H(+) + O-phospho-L-threonyl-[protein]

Subunit

Interacts with kif2c and kif11.
Interacts with CPEB1, JTB, TACC1, TPX2, PPP2CA, as well as with the protein phosphatase type 1 (PP1) isoforms PPP1CA, PPP1CB and PPP1CC (By similarity). Interacts also with its substrates ARHGEF2, BORA, BRCA1, KIF2A, PARD3, and p53/TP53. Interaction with BORA promotes phosphorylation of PLK1. Interacts with GADD45A, competing with its oligomerization (By similarity). Interacts with FBXL7 and PIFO. Interacts (via C-terminus) with AUNIP (via C-terminus) (By similarity). Identified in a complex with AUNIP and NIN (By similarity). Interacts with SIRT2 (By similarity). Interacts with FRY; this interaction facilitates AURKA-mediated PLK1 phosphorylation. Interacts with MYCN; interaction is phospho-independent and triggers AURKA activation; AURKA competes with FBXW7 for binding to unphosphorylated MYCN but not for binding to phosphorylated MYCN (By similarity). Interacts with HNRNPU (By similarity). Interacts with AAAS (By similarity).
Interacts with CPEB1, JTB, TACC1, TPX2, PPP2CA, as well as with the protein phosphatase type 1 (PP1) isoforms PPP1CA, PPP1CB and PPP1CC (By similarity). Interacts also with its substrates ARHGEF2, BORA, BRCA1, KIF2A, PARD3, and p53/TP53. Interaction with BORA promotes phosphorylation of PLK1. Interacts with FBXL7 and PIFO. Interacts with GADD45A, competing with its oligomerization (By similarity). Interacts (via C-terminus) with AUNIP (via C-terminus) (By similarity). Identified in a complex with AUNIP and NIN (By similarity). Interacts with SIRT2 (By similarity). Interacts with FRY; this interaction facilitates AURKA-mediated PLK1 phosphorylation (By similarity). Interacts with MYCN; interaction is phospho-independent and triggers AURKA activation; AURKA competes with FBXW7 for binding to unphosphorylated MYCN but not for binding to phosphorylated MYCN (By similarity). Interacts with HNRNPU (By similarity). Interacts with AAAS (By similarity).

Miscellaneous

Centrosome amplification can occur when the cycles are uncoupled, and this amplification is associated with cancer and with an increase in the levels of chromosomal instability.

Similarity

Belongs to the protein kinase superfamily.
Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. Aurora subfamily.

Keywords

ATP-binding   Cell cycle   Cell division   Cytoplasm   Cytoskeleton   Kinase   Microtubule   Mitosis   Nucleotide-binding   Phosphoprotein   Transferase   3D-structure   Alternative splicing   Cell projection   Cilium   Complete proteome   Isopeptide bond   Proto-oncogene   Reference proteome   Ubl conjugation  

Feature

chain  Aurora kinase A-A
splice variant  In isoform 2.

Uniprot

H9JAY6   A0A2A4J4B0   A0A2H1VUQ0   A0A212EVI6   A0A0L7L337   S4PLF3   + More
A0A1C9EGH0   A0A194QJ70   A0A194RNY2   M3XKI8   A0A1L8ELH7   A0A1L8ESU8   Q91820   Q91819   A0A2A3EAH8   A0A087ZXW3   G3HBL6   Q28HZ5   B5DFP5   A0A091V3E5   A0A087VKZ9   A0A1U7R6R7   A0A091H823   Q3MHU2   A0A151NYV8   Q7TNK2   Q3TEY6   P97477   K7G824   A0A2T7NIA0   P59241   A0A2P4Y0B0   A0A099YWA5   P97477-2   Q010G9   G3WJ52   A0A1X7VED6   A0A225WSH3   D0NUI6   F7ASA8   V8NVD6   H3B947   A0A2I0TNT3   A0A2I0M5W6   A0A1W4WSM8   V4A8Z0   L1IU42   A0A232EXQ7   K7JAY3   A0A1U7QWD0   A0A091W399   H9GMT8   A0A093HWJ7   E1BVE1   A0A060Y833   G1PAC6   R0KDE3   U3IAE4   F6S2E1   W2W8U2   W2IBC2   W2KG09   V9EGC6   A0A0W8CBA6   W2PNT8   Q8BP87   W2YJF0   A0A080ZGT4   W2MNH0   H0WPW8   A0A1J1IC17   A0A2Y9IM04   D7ELW1   A0A2Y9Q6F5   A0A2P4T2Q2   A0A1W2W3M3   A0A0W8D4G9   A0A1S3FT78   A0A1A6FYP0   A0A2Y9QCE6   A0A341BTD3   A0A1S3WNV3   A0A2P4XCZ7   A0A087QS09   A0A226PHT5   C1MQG5   A0A3Q1GSL9   A0A1V4KE16   A0A154P152   A0A2Y9ELJ1   F7A0P0   A4S3J2   A0A226MHJ8   A0A2Y9INE5   A0A3B3RXY0   A0A3P8SMK4   A0A3P8SMT4   A0A2Y9ELJ6   B5X2V6   I6V4W2  

EC Number

2.7.11.1

Pubmed

19121390    22118469    26227816    23622113    26354079    9215903    + More
27762356    9454730    10329703    18434591    21804562    29704459    20431018    15489334    15057822    15632090    22293439    10349636    11042159    11076861    11217851    12466851    12040188    16141073    9245792    9205101    9514916    16141072    15793587    19075002    19668197    21183079    20643351    22306998    22753416    18579375    18678489    23807208    17381049    12124350    19812038    28186564    16868079    21709235    19741609    17495919    24297900    23371554    23254933    23201678    28648823    20075255    21881562    15592404    24755649    21993624    23749191    18464734    18362917    19820115    24621616    19359590    12481130    15114417    17460045    29240929    20433749   

EMBL

BABH01008325    NWSH01003171    PCG66831.1    ODYU01004533    SOQ44518.1    AGBW02012180    + More
OWR45510.1    JTDY01003244    KOB69887.1    GAIX01004055    JAA88505.1    KX778609    AON96600.1    KQ458793    KPJ04975.1    KQ459984    KPJ19119.1    AFYH01027207    AFYH01027208    AFYH01027209    CM004483    OCT60187.1    CM004482    OCT62407.1    Z17207    BC072133    Z17206    BC075177    KZ288308    PBC28700.1    JH000271    RAZU01000236    EGW11017.1    RLQ63681.1    AAMC01123675    AAMC01123676    CR760668    KV460429    CAJ82185.1    OCA18246.1    BC169141    AAI69141.1    KL410577    KFQ97303.1    KL497174    KFO13291.1    KL525231    KFO90967.1    AC131024    BC104676    CH474062    AAI04677.1    EDL85147.1    AKHW03001485    KYO42062.1    AY336976    AAQ16152.1    AK145968    AK169363    CH466551    BAE26793.1    BAE41112.1    EDL06601.1    U80932    AF007817    U69106    AK085861    BC005425    BC014711    AGCU01129861    AGCU01129862    AGCU01129863    PZQS01000012    PVD20894.1    AF537333    NCKW01006561    POM71234.1    KL885837    KGL73233.1    CAID01000010    CAL56063.1    AEFK01024103    NBNE01000309    OWZ20585.1    DS028164    EEY65332.1    AZIM01001870    ETE65492.1    KZ508257    PKU35440.1    AKCR02000035    PKK25077.1    KB202544    ESO89771.1    JH993038    EKX39637.1    NNAY01001682    OXU23236.1    AAZX01011334    KK734682    KFR10122.1    AAWZ02020085    KL206811    KFV86021.1    AADN05000479    FR908224    CDQ87896.1    AAPE02030398    KB742479    EOB08007.1    ADON01010430    ANIX01003357    ETP06962.1    KI688439    KI675217    ETK77321.1    ETL30767.1    KI681915    ETL84012.1    ANIZ01002956    ETI37112.1    LNFO01004195    KUF81362.1    KI669616    ETN02658.1    AK077513    BAC36838.1    ANIY01003537    ETP35051.1    ANJA01003141    ETO65845.1    KI695163    ETM37198.1    AAQR03050642    AAQR03050643    AAQR03050644    CVRI01000047    CRK97821.1    DS497934    EFA12426.1    PPHD01011082    POI30636.1    LNFO01001495    KUF91020.1    LZPO01113206    OBS58680.1    NCKW01011496    POM63420.1    KL225851    KFM04013.1    AWGT02000072    OXB79254.1    GG663738    EEH57705.1    LSYS01003456    OPJ82719.1    KQ434796    KZC05563.1    EAAA01002391    CP000590    ABO98397.1    MCFN01000860    OXB54786.1    BT045375    ACI33637.1    JX020948    AFN06392.1   

Proteomes

UP000005204    UP000218220    UP000007151    UP000037510    UP000053268    UP000053240    + More
UP000008672    UP000186698    UP000242457    UP000005203    UP000001075    UP000273346    UP000008143    UP000053283    UP000189705    UP000002494    UP000050525    UP000000589    UP000007267    UP000245119    UP000053641    UP000009170    UP000007648    UP000007879    UP000198211    UP000006643    UP000002280    UP000053872    UP000192223    UP000030746    UP000011087    UP000215335    UP000002358    UP000189706    UP000053605    UP000001646    UP000053584    UP000000539    UP000193380    UP000001074    UP000016666    UP000002279    UP000018958    UP000053236    UP000053864    UP000054423    UP000018721    UP000052943    UP000018817    UP000018948    UP000028582    UP000054532    UP000005225    UP000183832    UP000248482    UP000007266    UP000248483    UP000081671    UP000092124    UP000252040    UP000079721    UP000053286    UP000198419    UP000001876    UP000257200    UP000190648    UP000076502    UP000008144    UP000001568    UP000198323    UP000261540    UP000265080    UP000248484    UP000087266   

PRIDE

H9JAY6    G3HBL6    P97477    P59241   

Pfam

PF00069   Pkinase        + More
PF00210   Ferritin

Interpro

IPR017441   Protein_kinase_ATP_BS        + More
IPR000719   Prot_kinase_dom       
IPR008271   Ser/Thr_kinase_AS       
IPR030616   Aur       
IPR011009   Kinase-like_dom_sf       
IPR030611   AURKA       
IPR009078   Ferritin-like_SF       
IPR009040   Ferritin-like_diiron       
IPR012347   Ferritin-like       
IPR008331   Ferritin_DPS_dom       

SUPFAM

SSF56112   SSF56112        + More
SSF47240   SSF47240       

Gene 3D

1.20.1260.10    

CDD

cd14116  STKc_Aurora-A

ProteinModelPortal

H9JAY6   A0A2A4J4B0   A0A2H1VUQ0   A0A212EVI6   A0A0L7L337   S4PLF3   + More
A0A1C9EGH0   A0A194QJ70   A0A194RNY2   M3XKI8   A0A1L8ELH7   A0A1L8ESU8   Q91820   Q91819   A0A2A3EAH8   A0A087ZXW3   G3HBL6   Q28HZ5   B5DFP5   A0A091V3E5   A0A087VKZ9   A0A1U7R6R7   A0A091H823   Q3MHU2   A0A151NYV8   Q7TNK2   Q3TEY6   P97477   K7G824   A0A2T7NIA0   P59241   A0A2P4Y0B0   A0A099YWA5   P97477-2   Q010G9   G3WJ52   A0A1X7VED6   A0A225WSH3   D0NUI6   F7ASA8   V8NVD6   H3B947   A0A2I0TNT3   A0A2I0M5W6   A0A1W4WSM8   V4A8Z0   L1IU42   A0A232EXQ7   K7JAY3   A0A1U7QWD0   A0A091W399   H9GMT8   A0A093HWJ7   E1BVE1   A0A060Y833   G1PAC6   R0KDE3   U3IAE4   F6S2E1   W2W8U2   W2IBC2   W2KG09   V9EGC6   A0A0W8CBA6   W2PNT8   Q8BP87   W2YJF0   A0A080ZGT4   W2MNH0   H0WPW8   A0A1J1IC17   A0A2Y9IM04   D7ELW1   A0A2Y9Q6F5   A0A2P4T2Q2   A0A1W2W3M3   A0A0W8D4G9   A0A1S3FT78   A0A1A6FYP0   A0A2Y9QCE6   A0A341BTD3   A0A1S3WNV3   A0A2P4XCZ7   A0A087QS09   A0A226PHT5   C1MQG5   A0A3Q1GSL9   A0A1V4KE16   A0A154P152   A0A2Y9ELJ1   F7A0P0   A4S3J2   A0A226MHJ8   A0A2Y9INE5   A0A3B3RXY0   A0A3P8SMK4   A0A3P8SMT4   A0A2Y9ELJ6   B5X2V6   I6V4W2  

PDB

3DJ7     E-value=1.76054e-101,     Score=942

KEGG

101738268    K11481 aurora kinase A [EC:2.7.11.1] | (RefSeq) serine/threonine-protein kinase Aurora-2-like

GO

GO:0005524   GO:0004674   GO:0004672   GO:0007100   GO:0007052   GO:0000212   GO:0090307   GO:0005737   GO:0005876   GO:0046777   GO:0000922   GO:0018105   GO:0019894   GO:0008017   GO:0051301   GO:0005813   GO:0000780   GO:0051233   GO:0035174   GO:0031616   GO:0032133   GO:0032465   GO:0007057   GO:1990138   GO:0031625   GO:0043203   GO:0072687   GO:0032091   GO:0009948   GO:0019901   GO:0005829   GO:0043066   GO:0045120   GO:0071539   GO:0032436   GO:0048471   GO:0051642   GO:0042585   GO:0046982   GO:0031647   GO:0097421   GO:1900195   GO:0097431   GO:0009611   GO:0005814   GO:0005634   GO:0000278   GO:0005815   GO:0007051   GO:0072686   GO:0000226   GO:0005654   GO:0005819   GO:0006468   GO:0015630   GO:0005929   GO:0051321   GO:0007098   GO:0032355   GO:0030030   GO:0006879   GO:0005623   GO:0008199   GO:0016567   GO:0006810   GO:0004889   GO:0005216   GO:0045211   GO:0016491   GO:0003824  

PANTHER

PTHR24350  

Subcellular location

Cytoplasm  
Cytoskeleton  
Spindle  
Microtubule organizing center  
Centrosome  
Spindle pole   Localizes to the spindle pole during mitosis especially from prophase through anaphase. Partially colocalized with gamma tubulin in the centrosome, from S to M phase (By similarity).   With evidence from 1 publications.
Cilium basal body   Localizes on centrosomes in interphase cells and at each spindle pole in mitosis (PubMed:9245792). Associates with both the pericentriolar material (PCM) and centrioles (By similarity). Colocalized with SIRT2 at centrosome (By similarity). Detected at the neurite hillock in developing neurons (PubMed:19668197). The localization to the spindle poles is regulated by AAAS (By similarity).   With evidence from 4 publications.
Centriole   Localizes on centrosomes in interphase cells and at each spindle pole in mitosis (PubMed:9245792). Associates with both the pericentriolar material (PCM) and centrioles (By similarity). Colocalized with SIRT2 at centrosome (By similarity). Detected at the neurite hillock in developing neurons (PubMed:19668197). The localization to the spindle poles is regulated by AAAS (By similarity).   With evidence from 4 publications.

Length:

318

Number of predicted TMHs:

0

Exp number of AAs in TMHs:

0.08457

Exp number, first 60 AAs:

0

Total prob of N-in:

0.01113

outside

1  -  318

 

 

Pi

141.161235

Theta

179.237711

Tajima's D

-0.613503

CLR

1.223718

CSRT

0.215439228038598

Interpretation

Uncertain