SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO05311
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 2.524
 

Sequence

CDS
ATGATCTATAAGACCATAATAAGGCCTGTTCTTATGTATGGCAGCGAAACATGGGCGGCAACCAAAAGGATCGTGCATACCATTCCAGTTGCTGAAATGAAAATGCTGAGGTGGATGTGCGGCGTGACTAGGCTCGATAGAATCCGCAACGAGTACGTGCGTGGAAGTCTAGGTGTACGGGACATCGCCGACAAGATGCAGGAGAGTAGGCTGAGATGGTATGGTCACGTGAAAAGGAAGCCACCTGACTACGTCGGAAATTTGGCGCTACTGCTCGACCTCCCCGGTCGGAGACCTAGAGGCAGACCCAAGACAAGGTGGAGGGACGTAGTGCTGAAGGACAAGAGAGAATGCAATGTTGCTGACGAAGATGTCGAAGACAGAGCGAAGTGGAGGAATAAAGTCAGGAATGCTGACCCCACCACCATGTGGGATAAATAG
Protein
MIYKTIIRPVLMYGSETWAATKRIVHTIPVAEMKMLRWMCGVTRLDRIRNEYVRGSLGVRDIADKMQESRLRWYGHVKRKPPDYVGNLALLLDLPGRRPRGRPKTRWRDVVLKDKRECNVADEDVEDRAKWRNKVRNADPTTMWDK

Summary

Pfam
PF00078   RVT_1
Interpro
IPR000477   RT_dom        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR001229   Jacalin-like_lectin_dom       
IPR036404   Jacalin-like_lectin_dom_sf       
SUPFAM
SSF56219   SSF56219        + More
SSF51101   SSF51101       
Gene 3D
ProteinModelPortal

Ontologies

Topology

Length:
146
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.0117
Exp number, first 60 AAs:
0.01156
Total prob of N-in:
0.31319
outside
1  -  146
 
 

Population Genetic Test Statistics

Pi
307.871474
Theta
170.64806
Tajima's D
2.614427
CLR
0.331822
CSRT
0.954452277386131
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号