SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO05295  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA002508
Annotation
PREDICTED:_pyruvate_kinase-like_isoform_X1_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 2.367
 

Sequence

CDS
ATGCCATTTAATTTTGTAACCGAAACGAAAAAAGGTGTCGATAAACCAAGATTCTCACTATCACTGAACAGAAATAATGCGCCACATTTGAGCAACGAAAACAAGAAAAATAACGAGAATATTAAAGAGAATACAGATCCATGCAGTTCTGGTAATAACAAGGAGAATAAGCCATTAAAGAGGCCGCTCAAAAGCATATATTCCAACACGTTGAGTGCAGCAAAAAAATTGAAGCCTCTAAGTGAATCATCGAAATCTGCAGGTCCCACAGTAAATAGGGACACAGCAACCCTAAAGCATTCAGACAGAACATTGAATCCAGAGCTAGCAATTCTGGAGGAGGGAGAATCAAGCTCGGTCATGTTGAATGGCCACCACCCTCCTGACACTCAATATGGAGGGGTGCAGAAGAAGATGCCTGTGTCTTCACTGTCCAATTTGGGGAACACTTGTTTTCTCAATAGTGTGCTTTATACTTTGAGGTATGCACCTCGGTTCCTGCACAACCTTCACCATTTAGTGTCAGATCTGGCCAGTGTTGAGCAAAAGTTGGGCAGCATCAGGCTCAAAAGTTCTTCATTGGGTCGGAGTGCTGCGGGCTTAGTATCATCTGGGACTAGATCATGGAGTAGCAAGGACTTGTTGTCATTAGGCCAGTCAGATAATAGTTCTGGAAAAAGTAAAATACAGATAGCGACAGAAAAACTTCACGAGACCTACTTTAATCTTCGTGCAGCTGAGAACAAATGTCTGAACAGCACCAATTCTGAGGCTACCCCTGAGCCATATGCAGCGGATGCCTTCTTGGCTGCTCTTAGAGATGTTAATTCTACTTTTGAAGGTAATCGACAGCAGGACGCTCATGAATTATTAGTTTGTATTTTGGACAACATACGGGAGACCTGCAGAGCGCTGAGTGCGCGCGCTGCTCGACTACAGATGCACGAAAACGGAGACAGTAACGGCATAGGCCGCCAGCCAAGCTTAGATGGAGACAACGGGAAACCAACATTAGGAAATCTTCGTAAGTCGTGGAAGAAACGCAAAGAAATCAAGGCAATCAACGACAAAAGGAATTCTCCGACTGAAGAACGGGAACCGTCGCCTGTGGATGCTGAGAAAGATGAGCGGTCGAGACCAGGATGGGACTTTGTGGCTGAAGATTTTGAAGGTACGATGGTAGTGCGGACCATGTGCTTAGAATGTGAAGCGGTCACTCAGAAGGCGCAGGCTGTTTGTGAGTTGTGCGTTCCGGTTGGCGAAGAAGAACCAGGAGCGGAACCGTTCCGGGCGGCCTGCCTGTCTACAGAATACCTGCGTGATCAGAACAAGTATTGGTGCGAACGTTGTCTACGGTACAACGAAGCTCGTCGCAGCGTCACTTATTCGAGACTGCCGCGGTTGCTGGTACTACAGTTGAAACGATTCAGCGGGGGAATGGAAAAGATAACAAGACATGCACCGACGCCTCTACTTATGCCTTGTTTCTGTGAGCCTTGCGCTTCCAGACCGCCCGAGCGTGCACCACAGCACAGATACATCCTATGGGCAGTGATAATGCACCTCGGTCAGACCCTAACAGGCGGGCATTACGTTGCTTATGCGCGCGATAGTTCTTGTGACTTCAAGTGCTCTCGTGAAGGTAGCGGACGGTTCGCGCTCTCCCGACGTGGAATTCAATTTTTCACTCGGAAGGGCAGTTCAAGATCACGTAAACCGCCCGTCAGTCGTAACCGAGAGCTCACAGACAAATATCTTCACTATAATCCATTAAAAATGGTTTACCCTACTATTCACGATGGCGAAATCGAGGCGGGTGCAGTTGAAAAGCCCACAGTCGCCAACGTCGGCTCCCAGCTCCAGCATATGTGCGGTCTCGACATTGACTCCAAGTCTTCGTACATCCGTCTCTCCGGAATAATCTGTACTATTGGACCGGCATCCCGTAATGTAGCTGTGCTAGAGAAGATGATGGAGACGGGAATGAACGTGGCAAGGATGAACTTCTCGCACGGTTCCCATGAGTACCACGCAGAGACCATTCGCAATTGTCGCGAGGCCGAGAAGAGTTACAGCGCTAAACTAGGTTCACCCTTCTCTTTGGCCATCGCATTGGACACTAAAGGACCTGAGATCAGAACTGGACTCTTGGAAGGCGGCGGCTCAGCTGAAGTCGAACTGAAGAAGGGAGAGACTATAAAGTTGACGACAAGTTCGGATTATCAAGAGAAAGGCAATGCTGATACAATTTACGTGGACTACAAGAACATAACGAATGTCGTGAAGCCAGGAAACCGAATCTTCATCGATGATGGCCTCATCTCTATCATCTGTCAGTCGGTCAGCGCTGACACTCTTACGTGTACCATTGAAAACGGAGGTATGCTCGGATCCCGGAAAGGCGTCAACCTGCCCGGCATACCCGTGGACCTACCCGCAGTCTCCGAGAAGGACAAGTCGGACCTGCTCTTCGGCGTCGAACAAGGCGTTGATATGATTTTCGCGTCATTCATCCGCAACGGCGCCGCGCTGCACGAGATTCGCGGCATCCTCGGCGAAAAAGGCAAGAACATCAAGATCATCTCCAAGATCGAAAATCACCAGGGAATGGTCAATTTAGACGAGATTATAGCTGAATCCGATGGTATCATGGTTGCTCGCGGAGATCTGGGTATCGAGATCCCTCCAGAAAAGGTATTCCTCGCCCAGAAGACCATGATCGCCAGATGCAATCGGGTTGGAAAACCAGTGATCTGTGCGACTCAAATGCTGGAATCCATGGTTAAGAAGCCCCGTCCCACCAGAGCCGAGATCTCTGACGTGGCCAACGCCATCCTCGACGGAGCTGACTGCGTGATGCTCTCCGGGGAGACTGCCAAGGGCGACTATCCTGTCGAGTGTGTTCACACCATGGCCAACATTTGCAAGGAGGCTGAAGCTGTAATCTGGCACAGGCAACTCTTCAATGACCTTGTGTCCGAGGTGAAGCCGCCGATCGATCCCGCGCACTCGGCCGCCATCGCCGCGGTGGAGGCGGCCACCAAGTGCCTGGCGTCGGCCATCGTGGTCATCACGACGAGCGGCAAGTCGGCGCACCTGCTCAGCAAGTACCGGCCGCGCTGCCCCATCATCGCCGTCACCAGGCACCCGCAGACCGCCAGGCAGGTGCACCTCTACCGCGGCGTGCTGCCCATCGTCTACCAAGAGCCGACGGCGTCGGACTGGCTGAAGGACGTGGACAACCGCGTGCAGAGCGGGCTGCGGTTCGGGCGGCAGCGCGGCTTCGTGCACCCCGGGGACAACGCGGTCGTCGTCACCGGCTGGAAGCAGGGCTCCGGCTTCACCAACACCGTCCGGGTCATTCAATTGGAATAA
Protein
MPFNFVTETKKGVDKPRFSLSLNRNNAPHLSNENKKNNENIKENTDPCSSGNNKENKPLKRPLKSIYSNTLSAAKKLKPLSESSKSAGPTVNRDTATLKHSDRTLNPELAILEEGESSSVMLNGHHPPDTQYGGVQKKMPVSSLSNLGNTCFLNSVLYTLRYAPRFLHNLHHLVSDLASVEQKLGSIRLKSSSLGRSAAGLVSSGTRSWSSKDLLSLGQSDNSSGKSKIQIATEKLHETYFNLRAAENKCLNSTNSEATPEPYAADAFLAALRDVNSTFEGNRQQDAHELLVCILDNIRETCRALSARAARLQMHENGDSNGIGRQPSLDGDNGKPTLGNLRKSWKKRKEIKAINDKRNSPTEEREPSPVDAEKDERSRPGWDFVAEDFEGTMVVRTMCLECEAVTQKAQAVCELCVPVGEEEPGAEPFRAACLSTEYLRDQNKYWCERCLRYNEARRSVTYSRLPRLLVLQLKRFSGGMEKITRHAPTPLLMPCFCEPCASRPPERAPQHRYILWAVIMHLGQTLTGGHYVAYARDSSCDFKCSREGSGRFALSRRGIQFFTRKGSSRSRKPPVSRNRELTDKYLHYNPLKMVYPTIHDGEIEAGAVEKPTVANVGSQLQHMCGLDIDSKSSYIRLSGIICTIGPASRNVAVLEKMMETGMNVARMNFSHGSHEYHAETIRNCREAEKSYSAKLGSPFSLAIALDTKGPEIRTGLLEGGGSAEVELKKGETIKLTTSSDYQEKGNADTIYVDYKNITNVVKPGNRIFIDDGLISIICQSVSADTLTCTIENGGMLGSRKGVNLPGIPVDLPAVSEKDKSDLLFGVEQGVDMIFASFIRNGAALHEIRGILGEKGKNIKIISKIENHQGMVNLDEIIAESDGIMVARGDLGIEIPPEKVFLAQKTMIARCNRVGKPVICATQMLESMVKKPRPTRAEISDVANAILDGADCVMLSGETAKGDYPVECVHTMANICKEAEAVIWHRQLFNDLVSEVKPPIDPAHSAAIAAVEAATKCLASAIVVITTSGKSAHLLSKYRPRCPIIAVTRHPQTARQVHLYRGVLPIVYQEPTASDWLKDVDNRVQSGLRFGRQRGFVHPGDNAVVVTGWKQGSGFTNTVRVIQLE

Summary

Uniprot
ProteinModelPortal
PDB
6DU6     E-value=0,     Score=2038

Ontologies

Topology

Length:
1124
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.1092
Exp number, first 60 AAs:
0
Total prob of N-in:
0.00306
outside
1  -  1124
 
 

Population Genetic Test Statistics

Pi
229.138981
Theta
178.401601
Tajima's D
1.058075
CLR
0.11888
CSRT
0.672816359182041
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
26280517 ACSWAARPWQGIIGHNDVIAK 95.12 2e-22
28556443 GVNLPGIPVDLPAVSEK 100.00 3e-10
25044914 IENCNYAVEIGR 95.83 6e-10
27102218 VFIAQK 95.83 6e-10
28467696 IENGTVVGFPGAK 95.83 6e-10
31250652 IAIGFMK 100.00 9e-07
31250652 SDLLFGVEQGVKPPIDPAHSAAIAAVEAATK 100.00 9e-07
31223520 KGVNLPGIPVDLPAVSEK 100.00 3e-06
28556443 GVLPIVYQEPTASDWLK 100.00 3e-06
28556443 GVLPIVYQEPTASDWLK 100.00 3e-06
28556443 GVLPIVYQEPTASDWLK 100.00 3e-06
28556443 GNADTIYVDYK 100.00 3e-06
28556443 GFVHPGDNAVVVTGWK 100.00 3e-06
26822097 MNFSHGSHEYHAETIR 100.00 4e-06
26280517 GDISSICWIESPIR 100.00 4e-06
25044914 GDYFGEIAIVTHKPR 100.00 4e-06
28467696 GDYIAAPDYNEK 100.00 4e-06
31223520 LGSPFSLAIALDTK 100.00 6e-06
26822097 AFAGAVEKPTVANVGSQIQHMCGIDIDSK 100.00 6e-06
26280517 EITAIAPSTMK 100.00 6e-06
25044914 GFSCSGVVGEDVVQGIK 100.00 6e-06
24402669 GFVGGMIDR 100.00 6e-06
27102218 CPIIAVTR 100.00 6e-06
28467696 GFTVVYK 100.00 6e-06
28556443 GDLGIEIPPEK 100.00 6e-06
28556443 GDLGIEIPPEK 100.00 6e-06
26822097 MMETGMNVAR 100.00 1e-05
26280517 INYGTGETFPHFR 100.00 1e-05
25044914 MNFAGK 100.00 1e-05
27102218 IIMPYTYIQQVPGK 100.00 1e-05
28467696 MNFFVQPVNEQAK 100.00 1e-05
28556443 QGSGFTNTVR 100.00 1e-05
31223520 GVNLPGIPVDLPAVSEK 100.00 2e-05
28556443 KGVNLPGIPVDLPAVSEK 100.00 2e-05
28556443 KGVNLPGIPVDLPAVSEK 100.00 2e-05
28556443 GVNLPGIPVDLPAVSEK 100.00 2e-05
28556443 IENHQGMVNLDEIIAESDGIMVAR 100.00 2e-05
28556443 SLAIALDTK 100.00 5e-05
28556443 SLAIALDTK 100.00 5e-05
31223520 GFVHPGDNAVVVTGWK 100.00 6e-05
28556443 GVLPIVYQEPTASDWLK 100.00 6e-05
28556443 GVLPIVYQEPTASDWLK 100.00 6e-05
28556443 QLFNDLVSEVKPPIDPAHSAAIAAVEAATK 100.00 1e-04
28556443 QGSGFTNTVR 100.00 1e-04
28556443 NITNVVKPGNR 100.00 1e-04
28556443 VGKPVICATQMLESMVK 100.00 0.006
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号