SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO05264
Pre Gene Modal
BGIBMGA002414
Annotation
reverse_transcriptase_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 2.759
 

Sequence

CDS
ATGGCGCCGCAATTCCAAGGAGTATCCCTGCAACCTTCCGAGAGTATCGGGATACTTGGGGTCGACATTTCGAGCGATGTCCAGTTTCGGAGTCATTTGGAAGGCAAAGCCAAGTTGGCGTCCAAAATGCTGGGAGTCCTCAACAGAGCAAAGCGGTACTTCACGCCTGGACAAAGACTTTTGCTTTATAAAGCACAAGTCCGGCCTCGCGTGGAGTACTGCTCCCATCTCTGGGCCGGGGCTCCCAAATACCAGCTTCTTCCATTTGACTCCATACAGAGGAGGGCCGTTCGGATTGTCGATAATCCCATTCTCACGGATCGTTTGGAGCCTCTGGGTCTGCGGAGGGACTTTGGTTCCCTCTGTATTCTGTACCGCATGTTCCATGGGGAGTGCTCTGAGGAATTGTTCGAGATGATACCGGCATCTCGTTTTTACCATCGCACCGCCCGCCACCGGAGTAGAGTTCATCCATACTACCTGGAGCCACTGCGGTCATCCACAGTCGTCGGAGACTGCGATTCGGCATTACGCCTCAACGAAGACAGCTACAAAGCGCGTCTTTACCTAACAAAGGCTTACAAGGAGTTGGATGAACATGACAAATACGAAACAAGTTTTAATGATTTGGAAAACAAATTTCCACAGCACCGTGACTTGACCGAATACTTCTTGAACAAGAGAGAAAATTTCGAAGAAGACGACGATAATTAA
Protein
MAPQFQGVSLQPSESIGILGVDISSDVQFRSHLEGKAKLASKMLGVLNRAKRYFTPGQRLLLYKAQVRPRVEYCSHLWAGAPKYQLLPFDSIQRRAVRIVDNPILTDRLEPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVVGDCDSALRLNEDSYKARLYLTKAYKELDEHDKYETSFNDLENKFPQHRDLTEYFLNKRENFEEDDDN

Summary

Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
Interpro
IPR000477   RT_dom        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR036691   Endo/exonu/phosph_ase_sf       
SUPFAM
SSF56219   SSF56219       
Gene 3D

Ontologies

Topology

Length:
237
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00043
Exp number, first 60 AAs:
0.00043
Total prob of N-in:
0.01347
outside
1  -  237
 
 

Population Genetic Test Statistics

Pi
40.948677
Theta
139.839928
Tajima's D
-0.412094
CLR
0.28957
CSRT
0.263536823158842
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号