SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO05245
Annotation
AF461149_1_transposase_[Bombyx_mori]
Full name
Signal transducer and activator of transcription      
Location in the cell
Cytoplasmic   Reliability : 1.088 Mitochondrial   Reliability : 1.304 Nuclear   Reliability : 1.302
 

Sequence

CDS
ATGTTCAATAACAGGCACTGGGTATTCCAACAAGATTCGGCGCCAGCTCATAGAGCGAAGAGCACACAAGACTGGCTGGCGGCGCGTGAAATCGACTTCATCCGTTACGAAGACTGGCCCTCCTCCAGTCCAGATTTGAATCCGTTAGATTACAAGATATGGCAACACTTGGAGGAAAAGGCGTGCTCAAAGCCTCATCCCAATTTGGAGTCACTCAAGACATCCTTGATTAAGGCAGCCGCCGATATTGACAATAACCTCGTTCGTGCTGCGATAGACGACTGGCCGCGCAGATTGAAGGCCTGTATTCAAAATCACGGAGGTTATTTGGAATAA
Protein
MFNNRHWVFQQDSAPAHRAKSTQDWLAAREIDFIRYEDWPSSSPDLNPLDYKIWQHLEEKACSKPHPNLESLKTSLIKAAADIDNNLVRAAIDDWPRRLKACIQNHGGYLE

Summary

Similarity
Belongs to the TGF-beta family.
Belongs to the transcription factor STAT family.
EMBL
AF461149    AAN06610.1    AB363028    BAG15927.1    AB473770    BAH20555.1    + More
AB363006    AB363010    AB363014    BAG15923.1    BAG15924.1    AB363018    BAG15926.1    RSAL01000021    RVE52408.1    RSAL01000012    RVE53510.1    RSAL01000114    RVE46946.1    RSAL01000063    RVE49524.1    RSAL01000931    RVE41042.1    RSAL01000387    RVE42024.1    RSAL01000004    RVE54604.1    RSAL01000131    RVE46422.1    RSAL01000140    RVE46091.1    RSAL01000300    RVE42771.1    RSAL01000174    RVE45058.1    RSAL01000209    RVE44259.1    RSAL01000022    RVE52367.1    RSAL01000200    RVE44486.1    RSAL01000470    RVE41612.1    U47917    AAB47739.1    PDUG01000005    PIC23776.1    LNIX01000030    OXA41211.1    UYSL01022144    VDL79905.1    UYSL01002425    VDL65835.1    DS268612    EFO94085.1    JF779677    AEO90418.1    CAVP010058755    CDL95145.1    UYSL01020634    VDL75527.1    UYSL01009772    VDL68385.1    JARK01001601    EYB87313.1    PDUG01000006    PIC20538.1    KN729202    KIH62598.1    UYSL01023059    VDL81638.1    DS268747    EFP00909.1    DS268433    EFO97645.1    JARK01001471    EYB97976.1    DS268420    EFO87874.1    KI662043    ETN73029.1    PDUG01000001    PIC51673.1    UYSL01019905    VDL71189.1    UYSL01019770    VDL69590.1    UYSL01021399    VDL78127.1    JARK01001658    EYB84158.1    DS268492    EFP11689.1    PIC29926.1    UYSL01019810    VDL70150.1    EFP11674.1    JARK01001411    EYC06502.1    DS268508    EFO83264.1    DS268428    EFO94379.1    DS268421    EFO88618.1    UZAH01026445    VDO80847.1    DS268466    EFP06959.1    DS268673    EFO98001.1    DS268606    EFO93488.1    DS268679    EFO98285.1    JARK01001337    EYC34439.1    DS268565    EFO90304.1    JARK01000255    EYC39473.1    JOJR01000015    RCN51257.1    DS268539    EFO88027.1    PDUG01000012    PIC13506.1    DS268525    EFO85497.1    JOJR01000583    RCN36166.1    UZAH01031030    VDP13493.1    UYSL01020109    VDL72812.1    KN726559    KIH67820.1    JARK01001418    EYC05389.1    DS268545    EFO88382.1    KN728435    KIH63782.1    UYSL01020934    VDL76658.1    PDUG01000004    PIC32571.1    HE601413    CAS00486.1    UYSL01020631    VDL75518.1    UZAH01001595    VDO19836.1   
Pfam
PF00019   TGF_beta        + More
PF00431   CUB
PF07776   zf-AD
PF00722   Glyco_hydro_16
PF01017   STAT_alpha
PF02864   STAT_bind
PF00017   SH2
PF02865   STAT_int
PF16095   COR
PF00069   Pkinase
PF13358   DDE_3
PF00292   PAX
PF10320   7TM_GPCR_Srsx
Interpro
IPR009057   Homeobox-like_sf        + More
IPR001839   TGF-b_C       
IPR029034   Cystine-knot_cytokine       
IPR017948   TGFb_CS       
IPR015615   TGF-beta-rel       
IPR000859   CUB_dom       
IPR035914   Sperma_CUB_dom_sf       
IPR012934   Znf_AD       
IPR000757   GH16       
IPR013320   ConA-like_dom_sf       
IPR012345   STAT_TF_DNA-bd_N       
IPR008967   p53-like_TF_DNA-bd       
IPR013799   STAT_TF_prot_interaction       
IPR013800   STAT_TF_alpha       
IPR013801   STAT_TF_DNA-bd       
IPR000980   SH2       
IPR015988   STAT_TF_coiled-coil       
IPR001217   STAT       
IPR036535   STAT_N_sf       
IPR036860   SH2_dom_sf       
IPR032171   COR       
IPR020859   ROC_dom       
IPR000719   Prot_kinase_dom       
IPR011047   Quinoprotein_ADH-like_supfam       
IPR011009   Kinase-like_dom_sf       
IPR008271   Ser/Thr_kinase_AS       
IPR027417   P-loop_NTPase       
IPR038717   Tc1-like_DDE_dom       
IPR001523   Paired_dom       
IPR036388   WH-like_DNA-bd_sf       
IPR036906   ATPase_V1_fsu_sf       
IPR017452   GPCR_Rhodpsn_7TM       
IPR000276   GPCR_Rhodpsn       
IPR019424   7TM_GPCR_Srsx       
SUPFAM
SSF46689   SSF46689        + More
SSF57501   SSF57501       
SSF49854   SSF49854       
SSF49899   SSF49899       
SSF48092   SSF48092       
SSF47655   SSF47655       
SSF49417   SSF49417       
SSF55550   SSF55550       
SSF56112   SSF56112       
SSF52540   SSF52540       
SSF50998   SSF50998       
PDB
5CR4     E-value=2.89539e-09,     Score=141

Ontologies

Topology

Subcellular location
Secreted  
Cytoplasm  
Nucleus  
Length:
111
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0
Exp number, first 60 AAs:
0
Total prob of N-in:
0.29180
outside
1  -  111
 
 

Population Genetic Test Statistics

Pi
66.03589
Theta
32.574425
Tajima's D
1.666065
CLR
0
CSRT
0.823958802059897
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号