SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO05197
Annotation
reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.395
 

Sequence

CDS
ATGGTCAGGAACGAAAGGCTATCTGCTCGTGGTGGTGGTACCGTCATTTACTATAGAAGAGCCTTGCATTGCGTCCCGCTCGATCTTCCGGCGCTCGCTAATATCGAAGCATCAGTGTGCCGAATCTCACTGACGGGACACGCGCCGATCGTTATCGCGTCCGTTTATCTTCCACCGGATAAGATCGTTCTAAGCAGTGATATCGAGGCGCTGCTCGGCATGGGGAGCTCTGTCATTCTGGCGGGAGACCTAAATTGTAAGCACATCAGGTGGAACTCACAAACCACAACCCTGAATGGCAGGCGGCTTGACGCGTTAGTCGATGATCTCGCCTTAGATATCGTCGCTCCGCTAACCCCGACTCACTACCCGCTAAATATCGCGCATCGCCCGGATATACTCGACATAGCGTTATTAAAAAACATAACTCTGCGCTTACACTCGATCGAAGTAGAGTTAGATTCAGACCACCGTCCCGTCGTTATGAAGCTCGGTCGCGCTCCCGATTCCATTCCCGTCACGAGGACTGTGGTGGATTGGCACGCGCTGGGCATCAGCCTGGCTGAATCTGATCCACCATCGCTCCCGTTTAGCCCGGACTCTACCCCGTCTCCTCAGGATACCGCTGAAGCCATAGACATCTTAACGTCACACATCACCTCGACATTACATAGATCATCGACACAAGTTGTAGCGGAGGACTTCCTTTACCGCTTCAAATTGCCCGACGATATTAGGGAACTCTTTAGAGCTAAGAACGCCTCGATACGCGCCTACGACAGGTAG
Protein
MVRNERLSARGGGTVIYYRRALHCVPLDLPALANIEASVCRISLTGHAPIVIASVYLPPDKIVLSSDIEALLGMGSSVILAGDLNCKHIRWNSQTTTLNGRRLDALVDDLALDIVAPLTPTHYPLNIAHRPDILDIALLKNITLRLHSIEVELDSDHRPVVMKLGRAPDSIPVTRTVVDWHALGISLAESDPPSLPFSPDSTPSPQDTAEAIDILTSHITSTLHRSSTQVVAEDFLYRFKLPDDIRELFRAKNASIRAYDR

Summary

Subunit
The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA.
Similarity
Belongs to the histone H2A family.
EMBL
AB055391    BAB21761.1    U07847    AAA17752.1    AB018558    BAA76304.1    + More
KQ459265    KPJ02064.1    AF081103    AAC72921.1    GEZM01008457    JAV94772.1    ABLF02012584    ABLF02013765    ABLF02024884    ABLF02008605    ABLF02008608    ABLF02008609    ABLF02008610    ABLF02017023    ABLF02008153    ABLF02008462    ABLF02008464    GEZM01099921    GEZM01099920    GEZM01099918    GEZM01099906    JAV53125.1    GEBQ01003077    JAT36900.1    JTDY01002082    KOB72150.1    ABLF02065839    ABLF02036316    ABLF02036319    ABLF02048663    ABLF02066977    GGMR01018716    MBY31335.1    GEZM01021868    JAV88847.1    ABLF02022418    ABLF02025082    ABLF02039175    ABLF02041809    ABLF02015631    ABLF02021986    ABLF02021987    ABLF02021991    ABLF02015632    ABLF02015633    KQ973342    KXZ75569.1    ABLF02037715    ABLF02010814    ABLF02010815    ABLF02037860    ABLF02037869    GGMR01012189    MBY24808.1    KK115285    KFM64681.1    JTDY01003188    KOB69997.1    JTDY01005246    KOB67202.1    ABLF02023911    GALX01005299    JAB63167.1    GFTR01008279    JAW08147.1    GFTR01008262    JAW08164.1    GGFK01009846    MBW43167.1    GGFK01009732    MBW43053.1    ABLF02023551    ABLF02023561    ABLF02041767    ABLF02005577    ABLF02009955    GGMR01012443    MBY25062.1    GGFL01005012    MBW69190.1    GGMS01006359    MBY75562.1    ABLF02027749    ABLF02058898    ABLF02009968    ABLF02049343    ABLF02056173    ABLF02063327    ABLF02065784   
Pfam
PF14529   Exo_endo_phos_2        + More
PF00078   RVT_1
PF14291   DUF4371
PF07530   PRE_C2HC
PF16211   Histone_H2A_C
PF00125   Histone
Interpro
IPR000477   RT_dom        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR005135   Endo/exonuclease/phosphatase       
IPR025398   DUF4371       
IPR006579   Pre_C2HC_dom       
IPR032458   Histone_H2A_CS       
IPR002119   Histone_H2A       
IPR032454   Histone_H2A_C       
IPR007125   Histone_H2A/H2B/H3       
IPR009072   Histone-fold       
IPR036397   RNaseH_sf       
IPR012337   RNaseH-like_sf       
SUPFAM
SSF56219   SSF56219        + More
SSF47113   SSF47113       
SSF53098   SSF53098       
Gene 3D

Ontologies

Topology

Subcellular location
Chromosome  
Nucleus  
Length:
261
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.09179
Exp number, first 60 AAs:
0.06507
Total prob of N-in:
0.17826
outside
1  -  261
 
 

Population Genetic Test Statistics

Pi
0
Theta
0
Tajima's D
0
CLR
0.300876
CSRT
0
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号