SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO05173
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Cytoplasmic   Reliability : 1.128 Mitochondrial   Reliability : 1.444 Nuclear   Reliability : 1.431
 

Sequence

CDS
ATGCTGATGTGGCTGTGCGGCGTGACTAGGCTCGATACAATCCGCAACGAGTACGTGCGTGGAAGCCTCGGTGTACGGGACATCGCCGACAAGATGCAGGAGAGTAGGCTGAGATGGTATGGTCACGTGAAAAGGAAGCCGCCTGACTACGTCGGAAATTCGGCGCTACTGCTCGACCTCCCCGGTCGAAGACCTAGAGGTAAACCCAAGACAAGTTGGAAGGACGTAGTGCTGAAGGACAAGAGAGAATGCAATGTTGCTGACGAGGATGTCGAAGACAGAGCGAAATGGAGGAGTAAAGTGAGGAAAGCTGACCCCGCCACCATGTGGGATAAATAG
Protein
MLMWLCGVTRLDTIRNEYVRGSLGVRDIADKMQESRLRWYGHVKRKPPDYVGNSALLLDLPGRRPRGKPKTSWKDVVLKDKRECNVADEDVEDRAKWRSKVRKADPATMWDK

Summary

EMBL
FJ265554    ADI61822.1    CU462842    CBA11992.1    LADI01004707    KPJ20598.1    + More
KQ459564    KPI99700.1    UZAH01037814    VDP50908.1    KN768094    KIH47114.1    UZAH01032715    VDP23439.1    KQ461154    KPJ08631.1    JARK01000539    EYC36061.1    JARK01001415    EYC05905.1    JARK01001430    EYC03360.1    JARK01001422    EYC04723.1    UZAH01038994    VDP55126.1    EYC03359.1    JARK01000281    EYC39011.1    JARK01001428    EYC03715.1    UZAF01001415    UZAF01017114    VDO08263.1    VDO38063.1    UZAH01036580    VDP46188.1    UZAH01025600    VDO67005.1    UZAH01036784    VDP47042.1    UZAH01033088    VDP26174.1    KZ348915    PIO65553.1    JARK01001382    EYC12765.1    UZAH01027944    VDO96393.1    KZ350014    PIO64310.1    JARK01001356    EYC21107.1    JARK01001340    EYC31495.1    JARK01001472    EYB97834.1    KZ346256    PIO70478.1    UZAH01026966    VDO87246.1    UZAH01035701    VDP42189.1    UZAH01004473    VDO27187.1    UZAH01026759    VDO85005.1    UZAH01027842    VDO95476.1    CAVP010061241    CDL96703.1    UZAH01027034    VDO87933.1    JARK01001375    EYC14890.1    UZAH01001784    VDO19994.1    CAVP010052206    CDL93749.1    JARK01001342    EYC29596.1    CAVP010057772    CDL94282.1    UZAH01027446    VDO91691.1    JARK01001722    JARK01001346    EYB81349.1    EYC26203.1    JARK01000336    EYC38182.1    CAVP010062000    CDL96883.1    JARK01001341    EYC29922.1    UZAH01026772    VDO85168.1    JARK01001437    EYC02250.1    UZAH01027307    VDO90480.1    CAVP010058665    CDL95025.1    CAVP010058483    CDL94742.1    UZAH01031849    VDP18192.1    UZAH01025305    VDO60984.1    UZAH01041841    VDP60735.1    UZAH01025623    VDO67507.1    UZAH01025844    VDO71503.1    UZAH01029524    VDP06516.1    JARK01001350    EYC24439.1    JARK01001380    EYC13251.1   
Pfam
PF00078   RVT_1        + More
PF03372   Exo_endo_phos
Interpro
IPR000477   RT_dom        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR005135   Endo/exonuclease/phosphatase       
SUPFAM
SSF56219   SSF56219       
Gene 3D

Ontologies

Topology

Length:
112
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0
Exp number, first 60 AAs:
0
Total prob of N-in:
0.19766
outside
1  -  112
 
 

Population Genetic Test Statistics

Pi
141.447504
Theta
130.24762
Tajima's D
1.032465
CLR
0
CSRT
0.671966401679916
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号