SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO05157
Annotation
gag-like_protein_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 3.38
 

Sequence

CDS
ATGGAGGTCGACCTCGACCCCGCCTTATCGACGGATGGATTCACCCTGGTACAAAAGGGTAAGAAGCGTGCCGCGGAGTCTCGAGCTCCCGCGGCCGCTAAAATTAGCAAAGCCGCGAACGCGTCTCGCCCCCGCCCTCAGACTCCCGTTGCGCCCCGAGCCCGTGCCACTCCGACGCCGCGTCCGGTGGCACGAAATAAAACCCAGACCCCTCCCCCGGTTATGCTTCAAGAGAAGGCAACTTGGGATCGAGTTTGCCTGGCCCTTAAGGCCAAAAATATCAATTTCACGAATGCCCGTAATCTCGCGAACGGCATTCAAATTAAGGTTCAAACACCCGACGACCATAGGGCTCTCTCTTCTTACCTCCGTAAGGAGCGTATAAGTTTCCATACGTATACGCTTCAGGAGGAGCGCGAACTCCGTGCCGTCATACGTGGCATCCCTAAAGATTTGGATGCGGAGCTCGTCAAGGCCGACCTTCTCGAACAAGGTCTACCAGTTAACTCCGTACACCGCATGCACAGAGGCCGCGGAAGGGAGCCATACAACATGGTTCTCGTCGCCCTCCAGCCTACCCCTGAGGGTAAGCAAATATTCAGCATACGAACGGTCTGTAGGCTTTCCGGAATCGCCGTCGAAGCCCCACACAAGAAAGGCACACCTAGTCAGTGCCATAACTGTCAATTATACGGACGTTCTTCCCGTAACTGTCACGCGCGCAGTGTTAGCAACACTCCGGTTTGA
Protein
MEVDLDPALSTDGFTLVQKGKKRAAESRAPAAAKISKAANASRPRPQTPVAPRARATPTPRPVARNKTQTPPPVMLQEKATWDRVCLALKAKNINFTNARNLANGIQIKVQTPDDHRALSSYLRKERISFHTYTLQEERELRAVIRGIPKDLDAELVKADLLEQGLPVNSVHRMHRGRGREPYNMVLVALQPTPEGKQIFSIRTVCRLSGIAVEAPHKKGTPSQCHNCQLYGRSSRNCHARSVSNTPV

Summary

Pfam
PF07530   PRE_C2HC        + More
PF03372   Exo_endo_phos
PF13359   DDE_Tnp_4
PF14529   Exo_endo_phos_2
PF00078   RVT_1
PF07727   RVT_2
Interpro
IPR006579   Pre_C2HC_dom        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR036691   Endo/exonu/phosph_ase_sf       
IPR027806   HARBI1_dom       
IPR036179   Ig-like_dom_sf       
IPR003598   Ig_sub2       
IPR013783   Ig-like_fold       
IPR003599   Ig_sub       
IPR007110   Ig-like_dom       
IPR037448   Zig-8       
IPR000477   RT_dom       
IPR035979   RBD_domain_sf       
IPR013103   RVT_2       
SUPFAM
SSF56219   SSF56219        + More
SSF48726   SSF48726       
SSF54928   SSF54928       
Gene 3D

Ontologies

Topology

Length:
248
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0
Exp number, first 60 AAs:
0
Total prob of N-in:
0.00999
outside
1  -  248
 
 

Population Genetic Test Statistics

Pi
15.615064
Theta
25.20037
Tajima's D
-1.165844
CLR
34.339386
CSRT
0.109894505274736
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号