SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO05148
Annotation
PREDICTED:_LOW_QUALITY_PROTEIN:_probable_endochitinase_[Papilio_machaon]
Location in the cell
Extracellular   Reliability : 1.34
 

Sequence

CDS
ATGCTCGCGCTTATATATATAATTATAAAAAATGCGTATGCGTATGGCGTATGCCACAGAGGAGCAGATGACCGTGCAGCATTCGTATCTCTGCTCAAAGAATTGCGTCTGGCTTTCGAAGGTGAAGCCAAGACTTCAGGTCAGCCCCGGCTCCTGCTCACCGCCGCTGTACCGGCGTCGTTCGAGGCGATCGCCGCTGGATATGATGTACCGGAAATATCGAAATATTTGGTGAGGACGATTTTAACTGTTATGAGAAAAACATCTTGTAGCTAA
Protein
MLALIYIIIKNAYAYGVCHRGADDRAAFVSLLKELRLAFEGEAKTSGQPRLLLTAAVPASFEAIAAGYDVPEISKYLVRTILTVMRKTSCS

Summary

Uniprot
ProteinModelPortal
PDB
5WVH     E-value=7.23128e-28,     Score=301

Ontologies

Topology

Length:
91
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.09223
Exp number, first 60 AAs:
0.0595
Total prob of N-in:
0.18125
outside
1  -  91
 
 

Population Genetic Test Statistics

Pi
232.313569
Theta
135.046808
Tajima's D
2.486003
CLR
0.488577
CSRT
0.945752712364382
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号