SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO05005
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 2.358
 

Sequence

CDS
ATGGACCGTATTTGGGCGGACAGAAAGATCTCGAGGAATACCAAAAAGCAGCTCGTCACCTCCCTCGTCTTTTCCATTTTTCTCTACGGCGCAGAGACCCTCAAGAAAGCCGATCGCCAACGCATCGACGCGTTTGAGATGTGGTGCTGGAGGAAAATGCTCGGGATTCGTTGGACAGAACACAGAACCAAGGAATCCATTCTTACCGAGCTCAAAATTCCAATGCGCCTCAGCACTATATGCGCGCGGAGAAGTTTCGAGATCTTTGGACATATCGCCAGAAAGAGAGGTGAAAATCTGGAAAAGCTGCTGGTAACAGGCAAGGTATGCGGGAGAAGGCACAGAGGCAGAAATCCAATGCGCTGGTCGGACCAAATACGCTCCACTCTCAATATCTCAGTCCACGTTGCTATCCACACAGCCGAGAACAGGCAGGAATGGCGCAAGATGATGCAGGAGAAAGTTATTAGAGGAGGCCACGACCCTCAGCACTGA
Protein
MDRIWADRKISRNTKKQLVTSLVFSIFLYGAETLKKADRQRIDAFEMWCWRKMLGIRWTEHRTKESILTELKIPMRLSTICARRSFEIFGHIARKRGENLEKLLVTGKVCGRRHRGRNPMRWSDQIRSTLNISVHVAIHTAENRQEWRKMMQEKVIRGGHDPQH

Summary

Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
Interpro
IPR000477   RT_dom        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR005135   Endo/exonuclease/phosphatase       
IPR002138   Pept_C14_p10       
SUPFAM
SSF56219   SSF56219       
Gene 3D

Ontologies

Topology

Length:
164
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
1.10308
Exp number, first 60 AAs:
1.10112
Total prob of N-in:
0.46555
outside
1  -  164
 
 

Population Genetic Test Statistics

Pi
181.709158
Theta
145.625282
Tajima's D
0.778803
CLR
0
CSRT
0.592820358982051
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号