SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO04979
Annotation
PREDICTED:_uncharacterized_protein_LOC101747137_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 2.861
 

Sequence

CDS
ATGGCCTTCTGCTCCACAACTACTGCGCAGACTACTCTGACTTCAGAATTAGGGGAGCTGCACACGTTCACCGACGCCAGCGAGAAGGCCTACGCGTGTGCAGTCTATTGGCGTCAGAAGACAGATGAGAGCACCTACCGCGTCACGCTTCTAGCAGGGAAAGCCAGGGTGACCCCACTGAGACCAGTCTCTATCCCAAGGCTGGAGCTGCAAGCTGCACTGCTGGGGACAAGGATGGCGCAGGCGATAGCGAACGAATTGGACATCGCGGTCGGTGGAAGGACGTACTGGACTGACTCCAGCACAGTCCTGACATGGATAAAGACCGACCCACGCACGTTCAAACCTTTCGTCGCGCACCGACTCGCCGAGATAGAAGAGTCAACGAAGCCCCAAGAATGGCGATGGGTGCCTGGCTCGCAAAACCCAGCAGACGACGCAACTAGAGAGGCGCCGGCGGATTTCGACCACACGCATCGGTGGTTTAATGGACCCGAGTTCCTGTCGTGGGATGAATCGCGCTGGCCCAAGCCGCGAACCTTCAAGCAAGAACCGTCTGGAGAAGAGAAAGAGGCCTTCCTGGTCGCCACGGCGAGGACCGCTGACGCTCGACCCACGCCCGATCCGCACAGATTCTCGAGCTGGGTCAGGTTATTGAGAGCAACAGCCAGGGTCCTCCAATTTATTGAGCTGTGTCGACCCCGGAAGGAGAGCGCCTGCGTGTCCAGACAATTGAAGCAGCAAGATCCCACGTGGAGGACGACACGAACGAAGCAACCCCGATCCACATGGAAGTTAAGGACCCCGGAAGCACCTACAGAAGCATGGCTGCCGCTCGATCCGCCCCACTTGAAGAAGGCGGAGAAGATCCTACTGAGAAGCAGCCAAGGAGAGAGCTTCGGTGAAAAAGATCCCGAACGTCACCCCAAGTTGCGACGGCTCGACGTCGTGATGGAAGATGGCCTGTTGCGCCTGCGCGGACGTATCGACGCAGCGCAATACATAGATGCAGGCTGCAAGCGACCGATCGTGCTGGACGGGAAGCACGTGATAGCGAGATTATTGATCAAACACTATCACGAGGCGTTCCAGCACGGTAACCACGCAACGGTGATGAACGAGGTGCGGCAGCGCTACTGGATCCTAGTTCTAAGATCGATCATTCGAGCGACGGCCGTCCGATGCCAGTGAACGAGCGGCGGTCTGCTTAAGAGACCTGCCTCCAAGATGATCCTGCTGGTGCCTGCAACGAGCGACGAGCCCACGCCCATAGAGTCGCCACGACAAGGAGTCGGTGCTACGCACGAGGGGGAGGATGTTGGCGACAGCGGCGTCGCCCCACAATTATAG
Protein
MAFCSTTTAQTTLTSELGELHTFTDASEKAYACAVYWRQKTDESTYRVTLLAGKARVTPLRPVSIPRLELQAALLGTRMAQAIANELDIAVGGRTYWTDSSTVLTWIKTDPRTFKPFVAHRLAEIEESTKPQEWRWVPGSQNPADDATREAPADFDHTHRWFNGPEFLSWDESRWPKPRTFKQEPSGEEKEAFLVATARTADARPTPDPHRFSSWVRLLRATARVLQFIELCRPRKESACVSRQLKQQDPTWRTTRTKQPRSTWKLRTPEAPTEAWLPLDPPHLKKAEKILLRSSQGESFGEKDPERHPKLRRLDVVMEDGLLRLRGRIDAAQYIDAGCKRPIVLDGKHVIARLLIKHYHEAFQHGNHATVMNEVRQRYWILVLRSIIRATAVRCQXTSGGLLKRPASKMILLVPATSDEPTPIESPRQGVGATHEGEDVGDSGVAPQL

Summary

EMBL
AF530470    AAQ09229.1    AB042119    BAA95570.1    AB042118    BAA95569.1    + More
KQ459986    KPJ18861.1    RSAL01000375    RVE42106.1    NWSH01008670    PCG62455.1    AAZX01023278    LNIX01000039    OXA39294.1    LNIX01000003    OXA57597.1    LNIX01000019    OXA44812.1    OXA44855.1    LNIX01000004    OXA56382.1    LNIX01000015    OXA46575.1    LNIX01000007    OXA52015.1    JTDY01001530    KOB73634.1    GEHC01000914    JAV46731.1    JXUM01127084    KQ567147    KXJ69602.1    GAMC01017930    JAB88625.1    GAMC01020598    GAMC01020596    GAMC01020592    JAB85959.1    GAMC01020594    JAB85961.1    JXUM01013493    KQ560378    KXJ82704.1    GEHC01000967    JAV46678.1    GEHC01000872    JAV46773.1    GGFJ01001462    MBW50603.1    GGFJ01001476    MBW50617.1    GGFJ01000302    MBW49443.1    GGFJ01000218    MBW49359.1    JXUM01136032    KQ568367    KXJ69026.1    GGFL01005193    MBW69371.1    GEHC01000913    JAV46732.1    GGFL01001842    MBW66020.1    LNIX01000018    OXA45362.1    GGFL01001682    MBW65860.1    APCN01002024    JXUM01109099    KQ565290    KXJ71123.1    JXUM01005879    KQ560203    KXJ83865.1    AB110069    BAD01590.1    BAD01589.1    LN877231    CTR11689.1    GEHC01000947    JAV46698.1    JXUM01083542    KQ563383    KXJ73941.1    ODYU01003174    SOQ41584.1    JXUM01111221    KQ565482    KXJ70922.1    OXA55408.1    LNIX01000012    OXA48117.1    LSMT01000075    PFX28896.1    GCES01110894    JAQ75428.1    GCES01111900    JAQ74422.1    GCES01103975    JAQ82347.1    GCES01134385    JAQ51937.1    AAGJ04142769    AAGJ04142770    GCES01140631    JAQ45691.1    GEHC01000945    JAV46700.1    GCES01132273    JAQ54049.1    OXA55241.1    GDIP01004568    JAM99147.1    GDIP01036233    JAM67482.1    GBYX01459357    JAO22202.1    KL367527    KFD66131.1    KL367687    KFD60188.1    KL367480    KFD71819.1    GBYX01459355    JAO22204.1    AAGJ04001285    KL367737    KFD59786.1    AAGJ04091218    MRZV01000348    PIK51982.1    GCES01097275    JAQ89047.1    KL367508    KFD68106.1    AAGJ04095911    LSMT01000016    PFX33015.1    GCES01097166    JAQ89156.1    JXUM01151198    KQ571164    KXJ68235.1    JYDP01000216    KRZ02791.1    AAGJ04125735    AAGJ04146728    AAGJ04146729    IAAA01051064    LAA11179.1    AAGJ04008210    KQ460970    KPJ10166.1    JXUM01144298    KQ569759    KXJ68523.1    QOIP01000003    RLU24775.1    JYDT01000190    KRY82045.1    HAEJ01014775    SBS55232.1   
Pfam
PF03564   DUF1759        + More
PF05380   Peptidase_A17
PF00665   rve
PF18701   DUF5641
PF17921   Integrase_H2C2
PF05585   DUF1758
PF01565   FAD_binding_4
PF09129   Chol_subst-bind
PF00628   PHD
PF00078   RVT_1
Interpro
IPR040676   DUF5641        + More
IPR036397   RNaseH_sf       
IPR005312   DUF1759       
IPR001584   Integrase_cat-core       
IPR008042   Retrotrans_Pao       
IPR012337   RNaseH-like_sf       
IPR041588   Integrase_H2C2       
IPR008737   Peptidase_asp_put       
IPR001995   Peptidase_A2_cat       
IPR001878   Znf_CCHC       
IPR006094   Oxid_FAD_bind_N       
IPR016166   FAD-bd_PCMH       
IPR016164   FAD-linked_Oxase-like_C       
IPR016170   Cytok_DH_C_sf       
IPR015213   Cholesterol_OX_subst-bd       
IPR036318   FAD-bd_PCMH-like_sf       
IPR016169   FAD-bd_PCMH_sub2       
IPR016167   FAD-bd_PCMH_sub1       
IPR011011   Znf_FYVE_PHD       
IPR013083   Znf_RING/FYVE/PHD       
IPR001965   Znf_PHD       
IPR019787   Znf_PHD-finger       
IPR019786   Zinc_finger_PHD-type_CS       
IPR000253   FHA_dom       
IPR000477   RT_dom       
IPR036875   Znf_CCHC_sf       
IPR002999   Tudor       
IPR001841   Znf_RING       
IPR021109   Peptidase_aspartic_dom_sf       
IPR001969   Aspartic_peptidase_AS       
SUPFAM
SSF53098   SSF53098        + More
SSF56176   SSF56176       
SSF55103   SSF55103       
SSF57903   SSF57903       
SSF57756   SSF57756       

Ontologies

Topology

Length:
449
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00398
Exp number, first 60 AAs:
0.00045
Total prob of N-in:
0.00993
outside
1  -  449
 
 

Population Genetic Test Statistics

Pi
387.578495
Theta
208.572676
Tajima's D
2.960805
CLR
0.749905
CSRT
0.977001149942503
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号