SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO04978
Annotation
pyruvate_kinase_[Danaus_plexippus]
Full name
Pyruvate kinase      
Location in the cell
Mitochondrial   Reliability : 1.498
 

Sequence

CDS
ATGATAACTCGACAGGAATTAGGTTCTGATATAACACCGAAGAAGCTAGTCATTGCTCAGAAGAATATGATTGCACGTGCGAATAAGGCTAACGTTCCGGTCTGTGTCAACGCACATCTCCTAAGCAGCATGAGATACAAAAAATTACCACTAAGAGCGGAACTTTTGGATGTGGCGAACTGCATTCTGGATGGTGCCGACACTCTTGAATTATCTGCTGAAACAGCGGTCGGTCTGTACCCAGTCGACACTGTTGCCTGTTTAGCCAGTGCCTGTAAAGAAGCTGAAGCCTGCATCTGGTCTAAGCAGATTTTTCACGATTTTGTCGATAAGACGCCGATCCCGTGCGATCAAGCAACCGGTGTTGGATTAGCCGCGGTACTGGCAGCGCAGCGGTCATTAGCGGCCGCCATAATTGTCGTCACCACAACCGGGAAATCGGCGCAAATTGTATCTAAATACGGACCGAGATGTCCCATTATAGGTGTAACTAGATACGCTGCTATAGCTAGACAATTGCACTTGTGGAGAGGAATCATACCGCTTATTTTTGAGGGTACTTAA
Protein
MITRQELGSDITPKKLVIAQKNMIARANKANVPVCVNAHLLSSMRYKKLPLRAELLDVANCILDGADTLELSAETAVGLYPVDTVACLASACKEAEACIWSKQIFHDFVDKTPIPCDQATGVGLAAVLAAQRSLAAAIIVVTTTGKSAQIVSKYGPRCPIIGVTRYAAIARQLHLWRGIIPLIFEGT

Summary

Catalytic Activity
ATP + pyruvate = ADP + H(+) + phosphoenolpyruvate
Similarity
Belongs to the pyruvate kinase family.
Belongs to the class I-like SAM-binding methyltransferase superfamily. rRNA adenine N(6)-methyltransferase family.
EC Number
2.7.1.40
EMBL
AGBW02008537    OWR53070.1    KQ459606    KPI91277.1    NWSH01001903    PCG69730.1    + More
KQ461198    KPJ06022.1    ODYU01000922    SOQ36414.1    JTDY01003837    KOB68932.1    GEBQ01001009    JAT38968.1    APCN01005967    AAAB01008952    EAA10555.6    ATLV01021293    KE525316    KFB46264.1    KQ971361    EFA08832.2    KYB25941.1    GEBQ01024610    JAT15367.1    AXCN02001590    GGFL01004734    MBW68912.1    AXCM01000245    GGFK01000396    MBW33717.1    GGFK01000395    MBW33716.1    GAMD01003210    JAA98380.1    ADMH02000764    GGFL01004376    ETN65121.1    MBW68554.1    GGFM01000290    MBW21041.1    GGFM01006434    MBW27185.1    CH477898    EAT35243.1    GGFM01000291    MBW21042.1    EAT35242.1    LBMM01014568    KMQ85133.1    CH478516    EAT32846.1    LBMM01003236    KMQ93775.1    GL768000    EFZ12877.1    GEDC01020559    JAS16739.1    GEDC01010333    JAS26965.1    GAPW01000661    JAC12937.1    GL439967    EFN66515.1    AJWK01004665    AJWK01004666    AJWK01004667    KK107293    EZA53406.1    ADTU01016559    ADTU01016560    ADTU01016561    ADTU01016562    ADTU01016563    ADTU01016564    KQ435161    KZC14923.1    KQ976702    KYM77205.1    KQ982294    KYQ58406.1    KQ980157    KYN17435.1    KQ981432    KYN41677.1    BABH01010950    BABH01010951    BABH01010952    QOIP01000005    RLU23178.1    GFDL01006821    JAV28224.1    KQ978379    KYM94483.1    DS231979    EDS30184.1    GFDL01006824    JAV28221.1    GFDL01006857    JAV28188.1    AGBW02007775    OWR54577.1    KQ459220    KPJ02928.1    GFDL01006859    JAV28186.1    GAMC01005788    JAC00768.1    GECZ01004238    JAS65531.1    GFDF01001448    JAV12636.1    JXUM01023189    JXUM01023190    KQ560654    KXJ81422.1    GECZ01005099    JAS64670.1    GAMC01005787    JAC00769.1    GDAI01002239    JAI15364.1    KK854197    PTY12947.1    GFDF01001335    JAV12749.1    KY412773    ARQ20739.1    KX147661    ARI45065.1    GL448039    EFN85446.1    GECZ01024076    JAS45693.1    FX983728    BAX07227.1    LNIX01000004    OXA56448.1    AK417674    BAN20889.1    GBRD01012428    GBRD01012427    GBRD01012426    GBRD01012425    GBRD01012424    GBRD01012422    GBRD01010042    GBRD01010040    GBRD01010039    GBRD01010038    GBRD01006700    GBRD01006699    JAG55786.1    GBRD01010044    GBRD01010041    GBRD01002395    JAG55783.1    GBHO01024498    GBHO01023780    GBHO01010803    GBHO01010230    GBHO01006495    GBHO01006493    JAG19106.1    JAG19824.1    JAG32801.1    JAG33374.1    JAG37109.1    JAG37111.1    GBHO01010825    GBHO01010824    GBHO01010805    GBHO01010307    GBHO01010289    GBHO01009918    GDHC01007241    JAG32779.1    JAG32780.1    JAG32799.1    JAG33297.1    JAG33315.1    JAG33686.1    JAQ11388.1    FX983727    BAX07226.1    GL888432    EGI60975.1    ODYU01000813    SOQ36162.1    KK852651    KDR19430.1    GBHO01023781    GBHO01023776    GBHO01023775    GBHO01010806    GBHO01009950    GBHO01006502    GBHO01006497    JAG19823.1    JAG19828.1    JAG19829.1    JAG32798.1    JAG33654.1    JAG37102.1    JAG37107.1    KQ415008    KOC58948.1    GANO01002423    JAB57448.1    KQ435775    KOX74974.1    AK401522    BAM18144.1    LJIJ01000034    ODN04873.1    GEMB01002976    JAS00227.1   
Pfam
PF00224   PK        + More
PF02887   PK_C
PF00398   RrnaAD
Interpro
IPR011037   Pyrv_Knase-like_insert_dom_sf        + More
IPR015806   Pyrv_Knase_insert_dom_sf       
IPR036918   Pyrv_Knase_C_sf       
IPR040442   Pyrv_Kinase-like_dom_sf       
IPR015813   Pyrv/PenolPyrv_Kinase-like_dom       
IPR001697   Pyr_Knase       
IPR015795   Pyrv_Knase_C       
IPR015793   Pyrv_Knase_brl       
IPR018209   Pyrv_Knase_AS       
IPR020598   rRNA_Ade_methylase_Trfase_N       
IPR001737   KsgA/Erm       
IPR029063   SAM-dependent_MTases       
SUPFAM
SSF50800   SSF50800        + More
SSF51621   SSF51621       
SSF52935   SSF52935       
SSF53335   SSF53335       
Gene 3D
PDB
6DU6     E-value=2.5928e-47,     Score=472

Ontologies

Topology

Length:
187
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.51561
Exp number, first 60 AAs:
0.01227
Total prob of N-in:
0.11057
outside
1  -  187
 
 

Population Genetic Test Statistics

Pi
172.104067
Theta
190.829745
Tajima's D
-0.724061
CLR
0
CSRT
0.195240237988101
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号