SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO04919
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.675 Nuclear   Reliability : 1.957
 

Sequence

CDS
ATGTGGTGCTACCGTCGCATGTTACGCATCAGTTGGACGAACAGGGTTAGTGACGAAACCGTGCTTCAGCGCGTTCATATGTCCCGGAAAATGTTGCCTTCTATCAAAAAGCGCAAGATAGAATATCTAGGCCACGTGCTCGGGAACGATAGATACATGCTGCTGCAGTTGATAATGATGGGCAAAGTGGACGGAAAGAGATGTCCTGGGCGAAGTAAGAAGTCATGGCTCCGGAATATCCGGGAGTGGACCGGTATTGCCTCCGTCGAACAGCTGTTCCGACTGGCTGCTGATAGAGATGAATACCGGAAGCTAACGGCCAACCTTCAGGATTGA
Protein
MWCYRRMLRISWTNRVSDETVLQRVHMSRKMLPSIKKRKIEYLGHVLGNDRYMLLQLIMMGKVDGKRCPGRSKKSWLRNIREWTGIASVEQLFRLAADRDEYRKLTANLQD

Summary

EMBL
GU815089    ADF18552.1    NWSH01002736    PCG67606.1    KQ977522    KYN02133.1    + More
GBHO01041897    JAG01707.1    GDHC01017214    JAQ01415.1    GBRD01005612    JAG60209.1    KQ460652    KPJ12975.1    GGMS01008711    MBY77914.1    LBMM01003995    KMQ92919.1    GBHO01028834    JAG14770.1    ODYU01000306    SOQ34818.1    LBMM01001656    KMQ95932.1    NWSH01001998    PCG69477.1    GGMS01004979    MBY74182.1    GBHO01020011    GDHC01013600    JAG23593.1    JAQ05029.1    GGMR01013640    MBY26259.1    GGMR01005851    MBY18470.1    GGMS01000367    MBY69570.1    ABLF02012409    ABLF02012412    KZ150019    PZC74919.1    KZ149985    PZC75696.1    AFYH01119920    NWSH01000469    PCG76200.1    BART01031562    GAH15691.1    HACG01049496    CEK96361.1    HACG01049494    HACG01049495    CEK96359.1    CEK96360.1    HACG01049256    CEK96121.1    HACG01049492    CEK96357.1    AAGJ04161766    HACG01049490    HACG01049491    CEK96355.1    CEK96356.1    RQTK01000058    RUS89376.1    HACG01049244    HACG01049247    CEK96109.1    CEK96112.1    HACG01049248    HACG01049253    CEK96113.1    CEK96118.1    HACG01049251    HACG01049252    CEK96116.1    CEK96117.1    LBMM01006413    KMQ90631.1    HACG01049254    CEK96119.1    KZ149912    PZC78062.1    GGMR01016842    MBY29461.1    GBHO01034555    JAG09049.1    HACG01049255    CEK96120.1    HACG01049245    CEK96110.1    KF881087    AIJ27486.1    HACG01049249    CEK96114.1    NCKU01004395    RWS06003.1    RQTK01000357    RUS81065.1    KK852404    KDR24543.1    KK852870    KDR14607.1    ABLF02042206    KK853131    KDR10935.1    MRZV01000940    PIK42365.1    NCKU01012182    RWS00163.1    ABLF02024992    ABLF02024994    ABLF02025002    ABLF02043975    NCKU01008836    RWS01655.1    RQTK01000625    RUS76894.1    GGMR01016881    MBY29500.1    GGMS01006790    MBY75993.1    RQTK01000685    RUS76136.1    RQTK01000360    RUS81011.1    MRZV01000056    PIK60437.1    GGMR01009131    MBY21750.1    GFAH01000222    JAV48167.1    ODYU01006805    SOQ48998.1    KK852941    KDR13536.1    GDHC01009154    JAQ09475.1    MRZV01002322    PIK33998.1    KF881086    AIJ27485.1    GGMR01012724    MBY25343.1    RQTK01001448    RUS70261.1    GGMS01001437    MBY70640.1    GBRD01015972    GBRD01015971    GBRD01015970    JAG49854.1    KK852511    KDR22315.1    KK853249    KDR09341.1    MRZV01000378    PIK51329.1    KK852843    KDR15156.1    ABLF02028390    QIAP01000240    PYX61602.1    KZ150203    PZC72267.1    GBHO01034897    JAG08707.1    MRZV01000817    PIK43880.1    GBHO01033031    GBHO01015473    GBHO01015472    GBHO01015471    GBHO01015469    GBHO01013134    GBHO01013133    GBHO01013129    GBHO01013128    JAG10573.1    JAG28131.1    JAG28132.1    JAG28133.1    JAG28135.1    JAG30470.1    JAG30471.1    JAG30475.1    JAG30476.1    FJ265559    ADI61827.1    FJ265560    ADI61828.1    FJ265546    ADI61814.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF03221   HTH_Tnp_Tc5
PF04218   CENP-B_N
PF05699   Dimer_Tnp_hAT
Interpro
IPR036691   Endo/exonu/phosph_ase_sf        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR000477   RT_dom       
IPR036640   ABC1_TM_sf       
IPR006600   HTH_CenpB_DNA-bd_dom       
IPR007889   HTH_Psq       
IPR009057   Homeobox-like_sf       
IPR008906   HATC_C_dom       
IPR000637   HMGI/Y_DNA-bd_CS       
SUPFAM
SSF56219   SSF56219        + More
SSF90123   SSF90123       
SSF46689   SSF46689       
Gene 3D

Ontologies

Topology

Length:
111
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.0306
Exp number, first 60 AAs:
0.02804
Total prob of N-in:
0.59344
inside
1  -  111
 
 

Population Genetic Test Statistics

Pi
151.326549
Theta
140.610015
Tajima's D
0.2395
CLR
0
CSRT
0.43762811859407
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号