SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO04830
Pre Gene Modal
BGIBMGA009924
Annotation
PREDICTED:_glucose_dehydrogenase_[FAD?_quinone]-like_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.177
 

Sequence

CDS
ATGAAAAGGTCCTTATGGTGTGCTGCCATGGCGCTGGTGATCGGGTCGGCATCTGCAAGTTCATTGCTCCTTGATGACGTGGTGTATGACACACTATACCAATACCCACCTGGAATTATTCTGAAAGACGGAGCAGAATATGACTACGTTGTGGTCGGGGCGGGGGCGGCTGGTGCTGCGGCCGCTTCTCGACTGGCGCTGAAGGGGTTCAGTGTTGTACTCATAGAAGCCGGTGGTGATCCTGACGCACTTTCTAAAATCCCAATGGCTGCAATGGGGCTCCTCGGATCACCTATCGACTGGCAATACAAGACCATATCCAACAACGTATCCTGTCTCTCCTTTCAGGGTAAACAGTGCAGGTTTGCACGCGGAAAGTGTCTCGGAGGCTCAACTTCTATTAACTATATGCTGTACACCAGAGGAAACCGACTTGATTATGATGAAATGAACATTCCTGGCTGGAGATGGAAGGATTTGAAACCATATTTCCTCCGTTACGAAGGACTTCAAATCGCAAAAAATTACCCACCATCTTCAAGGATCTACCACAACACATCCGGCATTTTGAAAATTGAGTATTTCGATGATCCCCGAAATCCGTGGCAATTCCGGCTCGTCACTGGAATGAAGGATTTAAATGTGCCATTCAATAAAGATTTGAATGGAAAGAACCAAATCGGCGTGTCAAAGGTGGCGGGCTATGTGTACAAGGGTGAGCGCATGAGCACCGCTCGTGCGTACCTGTCTAGAGACGATGTTAAGAAAGCCTTAAACGTAGCCAAGAATGCTTTTTGTACCGGTGTCATCATAGATGACAATAATGTCGCAAGGGGCGTAACAGTCATTCAAGGTCTGCTGAATGTAACCGTGTTAGCGCGGAAAGAAGTAATCTTGAGTGCAGGCGCAGTTGGAACTCCACAGATTCTTATGTTATCAGGCATAGGACCAGATTATCATTTAAAAAGTTTGGGAATTAAAGTGCGGAAAAATCTGACAGTCGGTGACGATATGAGTGACCACGTCCTACCGCTGATAATAGTTAAAGTGGATAAAGGACACAGCATACCTCAAAAATTATCACCACTTATTGGGAGAGCAGCACAACTTGGGCAATTCCTCGTGGCTGGAGATGGACCCCTAGCTTCTAATGGCATTACGGATATTGTTACCTTAATGAACAGCGATTGCTATGATTACAAAAATCGTAAACTGTATAATAATAGTACTAAATGTGAATACGCAGACTTGCAGATCATTGCCGCCTACGTCGACAGGAGCTTGGTGACAGTCGCGAAACCATTGTTCAAGCACGCGATAGGTCTCAACGACGACGTTGTTGAACAGATAAGTAAAGCGAACGAGGATTACGCTTTAATAATTTTATCACCGGTCGTATTGAAACCGTATTCTCGTGGTAATATCCGTCTCGCTAGTGCTGATCCTACCGAACAACCCGCGATATTCGCTAACTACTTAGGAGATTCCCGAGATGTCGATCAAATGCTGAAACACATAATAGTTTTAGAGCATCTGGTGGAAGCGCCGACCTTTAAGAAACAGAATGCCTCAATCCTGCATCTAAACCTACCTGAATGTCCATCTTATGAAAAATCTAGAGTAAAATATTGGAGATGCTATGCAAGGAGTATGACTTATGCCGTCTATCACGCCGTGGGGACATGTGCGCTGCAAAGAGTGGTTAATGAAAAGCTTCAAGTGTATGGCGTGAAGAATTTAAGAGTTGCCGATTTGAGCGTAATGAAGAAACTAGTTAGGGGCAATACAGAGGCAGTATCAGTAGCTATCGGCGAGAGACTAGTTGATCTCATCGTGGACGACTTGAATAAGAAGACGAAGTGTTGTCCTAGGGCTAAATAA
Protein
MKRSLWCAAMALVIGSASASSLLLDDVVYDTLYQYPPGIILKDGAEYDYVVVGAGAAGAAAASRLALKGFSVVLIEAGGDPDALSKIPMAAMGLLGSPIDWQYKTISNNVSCLSFQGKQCRFARGKCLGGSTSINYMLYTRGNRLDYDEMNIPGWRWKDLKPYFLRYEGLQIAKNYPPSSRIYHNTSGILKIEYFDDPRNPWQFRLVTGMKDLNVPFNKDLNGKNQIGVSKVAGYVYKGERMSTARAYLSRDDVKKALNVAKNAFCTGVIIDDNNVARGVTVIQGLLNVTVLARKEVILSAGAVGTPQILMLSGIGPDYHLKSLGIKVRKNLTVGDDMSDHVLPLIIVKVDKGHSIPQKLSPLIGRAAQLGQFLVAGDGPLASNGITDIVTLMNSDCYDYKNRKLYNNSTKCEYADLQIIAAYVDRSLVTVAKPLFKHAIGLNDDVVEQISKANEDYALIILSPVVLKPYSRGNIRLASADPTEQPAIFANYLGDSRDVDQMLKHIIVLEHLVEAPTFKKQNASILHLNLPECPSYEKSRVKYWRCYARSMTYAVYHAVGTCALQRVVNEKLQVYGVKNLRVADLSVMKKLVRGNTEAVSVAIGERLVDLIVDDLNKKTKCCPRAK

Summary

Cofactor
FAD
Similarity
Belongs to the GMC oxidoreductase family.
EMBL
BABH01026760    BABH01026761    KZ150126    PZC73113.1    JTDY01001166    KOB74675.1    + More
NWSH01004950    PCG64563.1    AGBW02008930    OWR52172.1    AGBW02010600    OWR48201.1    JTDY01000443    KOB77147.1    RSAL01000892    RSAL01000018    RVE41068.1    RVE52863.1    JTDY01004610    KOB67954.1    GEBQ01016745    JAT23232.1    KY618826    AQW43012.1    KY618825    AQW43011.1    RSAL01000051    RVE50264.1    KU764422    AQS60669.1    GEBQ01029705    JAT10272.1    GEBQ01006583    JAT33394.1    APGK01055703    APGK01055704    KB741269    ENN71448.1    AAZX01008029    GL763984    EFZ18935.1    KQ981296    KYN43080.1    LBMM01005695    KMQ91287.1    KK107261    EZA53937.1    GL888284    EGI63349.1    NEVH01020853    PNF21087.1    QOIP01000012    RLU16172.1    EGI63344.1    GECU01004364    JAT03343.1    KQ434869    KZC09326.1    GEBQ01030587    JAT09390.1    KQ759784    OAD62856.1    KQ980314    KYN16692.1    ADTU01026685    GFXV01007441    MBW19246.1    GL442298    EFN63615.1    KQ971348    EFA05531.1    KQ435704    KOX80305.1    BABH01003797    ADTU01026680    GL448571    EFN84162.1    GBXI01017045    GBXI01016813    GBXI01008932    JAC97246.1    JAC97478.1    JAD05360.1    ABLF02037928    KQ414579    KOC71127.1    BABH01003799    PYGN01000411    PSN46845.1    NEVH01005904    PNF38181.1    NNAY01000267    OXU29610.1    GFDF01002041    JAV12043.1    NEVH01022362    PNF18877.1    AJVK01024561    AJVK01024562    KK869577    KDR06647.1    GECZ01027417    JAS42352.1    GFDF01002042    JAV12042.1    LNIX01000033    OXA40594.1    GGMS01006576    MBY75779.1    GGMR01012313    MBY24932.1    KZ288238    PBC31347.1    CH916370    EDW00246.1    ODYU01005276    SOQ45969.1    JH431861    GAMC01020243    JAB86312.1    GBHO01012330    GBRD01008695    GBRD01008694    JAG31274.1    JAG57126.1    GBYB01002620    JAG72387.1    GECU01001143    JAT06564.1    GEBQ01030254    JAT09723.1    KYN43074.1    AJWK01014080    GECZ01017548    JAS52221.1    GAKP01015844    JAC43108.1    DS235784    EEB16963.1    KQ460323    KPJ15961.1    NEVH01009076    PNF33851.1    GGMS01001005    MBY70208.1    OXA40505.1    GEDC01015002    GEDC01002775    JAS22296.1    JAS34523.1    KOC71128.1    GECU01008742    JAS98964.1    JRES01000943    KNC26974.1    GDIQ01162162    GDIQ01145021    GDIQ01143630    JAL06705.1    GECU01032039    JAS75667.1    GDIQ01207189    JAK44536.1    RLU16179.1    KQ982806    KYQ50436.1    GL438602    EFN68710.1    EEB16969.1    GDIQ01200150    GDIQ01198855    JAK52870.1    GDIP01238481    GDIQ01236187    GDIQ01234983    JAI84920.1    JAK15538.1    NEVH01019370    PNF22796.1    KK852802    KDR16286.1    NWSH01001458    PCG71174.1    ODYU01012241    SOQ58442.1    GDIQ01101823    JAL49903.1    GDIQ01112973    JAL38753.1    BABH01003798    GDIQ01101824    JAL49902.1    GDIQ01051490    JAN43247.1   
Pfam
PF00732   GMC_oxred_N        + More
PF05199   GMC_oxred_C
Interpro
IPR000172   GMC_OxRdtase_N        + More
IPR012132   GMC_OxRdtase       
IPR007867   GMC_OxRtase_C       
IPR036188   FAD/NAD-bd_sf       
SUPFAM
SSF51905   SSF51905       
Gene 3D
PDB
4YNU     E-value=6.255e-36,     Score=380

Ontologies

Topology

SignalP
Position:   1 - 19,         Likelihood:  0.995847
 
 
Length:
626
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
6.58098999999999
Exp number, first 60 AAs:
6.19625
Total prob of N-in:
0.29266
outside
1  -  626
 
 

Population Genetic Test Statistics

Pi
1.497369
Theta
6.584948
Tajima's D
-2.132514
CLR
278.602467
CSRT
0.00709964501774911
Interpretation
Possibly Positive selection

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号