SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO04814
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Cytoplasmic   Reliability : 1.064 Mitochondrial   Reliability : 1.355 Nuclear   Reliability : 1.746
 

Sequence

CDS
ATGGAGGAAACCAGAATGCTAAGACAACTACTATATGGCAAACCAGAGGGCCGGAGACGTCGTGACAGACCCAAACTCCGATGGTTGGATGGCGTAGAGGACGACCTTAAAGTTGTCGATGTCAAGAACTGGAATGAGAAATCCCTGAACAGAGCAGTCTCGAGAGACATACTGGACCAGGCTAAGGCCCATCCTGAACTGTAA
Protein
MEETRMLRQLLYGKPEGRRRRDRPKLRWLDGVEDDLKVVDVKNWNEKSLNRAVSRDILDQAKAHPEL

Summary

Pfam
PF00078   RVT_1        + More
PF03372   Exo_endo_phos
PF01386   Ribosomal_L25p
Interpro
IPR000477   RT_dom        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR005135   Endo/exonuclease/phosphatase       
IPR020056   Rbsml_L25/Gln-tRNA_synth_N       
IPR011035   Ribosomal_L25/Gln-tRNA_synth       
IPR029751   Ribosomal_L25       
SUPFAM
SSF56219   SSF56219        + More
SSF50715   SSF50715       
Gene 3D
ProteinModelPortal

Ontologies

Topology

Length:
67
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0
Exp number, first 60 AAs:
0
Total prob of N-in:
0.39962
outside
1  -  67
 
 

Population Genetic Test Statistics

Pi
44.855021
Theta
32.137177
Tajima's D
1.077447
CLR
0
CSRT
0.68271586420679
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号