SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO04688
Annotation
endonuclease_and_reverse_transcriptase-like_protein_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 2.386
 

Sequence

CDS
ATGCTGTCTATTGATGGCATGCATTGCTATGCGGATGACAGCACGGGGGATGCGCGATATATCGGCCATCAGAGTCTCTCTCGAAGCGTGGTGCAAGAGAGACGATCAAAACTTGTGTCTGAAGTGGAGAACTCTCTGGGGCGAGTCTCCAAATGGGGTGAATTGAACTTGGTTCAATTCAACCCGTTAAAGACACAAGTTTGCGCGTTCACTGCGAAGAAGGACCCCTTTGTCATGGCGCCGCAATTCCAAGGAGTATCCCTGCAACCTTCCGAGAGTATTGGGATACTTGGGGTCGACATTTCGAGCGATGTCCAGTTTCGGAGTCATTTGGAAGGCAAAGCCAAGTTGGCGTCCAAAATGCTGGGAGTCCTCAACAGAGCGAAGCGGTACTTCACGCCTGGACAAAGGCTTCTGCTTTATAAAGCACAAGTCCGGCCTCGCGTGGAGTACTGCTCCCATCTCTGGGCCGGGGCTCCCAAATACCAGCTTCTTCCATTTGACTCCATACAGAGGAGGGCCGTTCGGATTGTCGATAATCCCAATGTCACGGATCGTTTGGAACCTCTGGGTCTGCGGAGGGACTTCGGTTCTCTCTGTATTTTGTACCGTATGTTCCATGGGGAGTGCTCTGAGGAATTGTTCGAGATGATACCGGCATCTCGTTTTTACCATCGCACCGCCCGCCACCGGAGTAGAGTTCATCCGTACTACCTGGAGCCACTGCGGTCATCCACAGTGCGTTTCCAGAGATCTTTTTTGCCACGTACCATCCGGCTATGGAATGAGCTCCCCTCCACGGTGTTTCCCGAGCGCTATGACATGTCCTTCTTCAAACGAGGCTTGTGGAGAGTATTAAGCGGTAGGCAGCGGCTTGGCTCTGCCCCTGGCATTGCTGAAGTCCATGGGCAACGGTAA
Protein
MLSIDGMHCYADDSTGDARYIGHQSLSRSVVQERRSKLVSEVENSLGRVSKWGELNLVQFNPLKTQVCAFTAKKDPFVMAPQFQGVSLQPSESIGILGVDISSDVQFRSHLEGKAKLASKMLGVLNRAKRYFTPGQRLLLYKAQVRPRVEYCSHLWAGAPKYQLLPFDSIQRRAVRIVDNPNVTDRLEPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERYDMSFFKRGLWRVLSGRQRLGSAPGIAEVHGQR

Summary

EMBL
AY359886    AAQ57129.1    AB126052    BAD86652.1    RSAL01002067    RVE40593.1    + More
RSAL01000487    RVE41561.1    RSAL01003136    RVE40332.1    RSAL01000422    RVE41792.1    RSAL01000002    RVE55041.1    RVE55094.1    RSAL01000164    RVE45343.1    ODYU01002162    SOQ39302.1    RVE54942.1    RSAL01000090    RVE48098.1    AMCI01002135    EJX03495.1    GDRN01105059    JAI57791.1    ODYU01007423    SOQ50184.1    DPOC01000269    HCX22453.1    HAAD01001474    CDG67706.1    LWDP01000391    ORD92879.1    GFAC01000919    JAT98269.1    GEGO01001118    JAR94286.1    GEFM01002394    JAP73402.1    MRZV01001153    PIK40187.1    GBIH01002577    JAC92133.1    GFAA01002657    JAU00778.1    JH815916    EKC31648.1    GFAA01002479    JAU00956.1    GFAA01002514    JAU00921.1    GANP01010920    JAB73548.1    GEGO01004630    JAR90774.1    GEGO01004433    JAR90971.1    GFAC01005646    JAT93542.1    GEFM01006417    JAP69379.1    GFAC01005665    JAT93523.1    GEFM01005882    JAP69914.1    GEFM01002324    JAP73472.1    AAGJ04106435    GDRN01111277    JAI56804.1    LSMT01000297    PFX20951.1    GEFM01006320    JAP69476.1    GEGO01002473    JAR92931.1    GEGO01003111    JAR92293.1    GFAA01004201    JAT99233.1    GDRN01111334    JAI56796.1    GFAC01005670    JAT93518.1    FLMD02000280    SCV66640.1    AGCU01117142    NSIT01000239    PJE78188.1    GEFM01002419    JAP73377.1    GEGO01003312    JAR92092.1    GFAA01003161    JAU00274.1    GFAA01003546    JAT99888.1    AGCU01204861    AAGJ04019135    NEDP02002733    OWF50189.1    AAGJ04028970    AGCU01124247    GEFM01006421    JAP69375.1    GEFM01001613    JAP74183.1    GEGO01003518    JAR91886.1    GFPF01007594    MAA18740.1    NSIT01000412    PJE77717.1    MRZV01000639    PIK46517.1    GEGO01003794    JAR91610.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF01585   G-patch
PF01873   eIF-5_eIF-2B
PF04939   RRS1
PF08159   NUC153
Interpro
IPR000477   RT_dom        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR036691   Endo/exonu/phosph_ase_sf       
IPR012677   Nucleotide-bd_a/b_plait_sf       
IPR000504   RRM_dom       
IPR034653   SPF45_RRM       
IPR003954   RRM_dom_euk       
IPR000467   G_patch_dom       
IPR040052   RBM17       
IPR035979   RBD_domain_sf       
IPR016190   Transl_init_fac_IF2/IF5_Zn-bd       
IPR002735   Transl_init_fac_IF2/IF5       
IPR016189   Transl_init_fac_IF2/IF5_N       
IPR007023   Ribosom_reg       
IPR036322   WD40_repeat_dom_sf       
IPR040382   NOL10/Enp2       
IPR012580   NUC153       
IPR001680   WD40_repeat       
IPR028082   Peripla_BP_I       
SUPFAM
SSF56219   SSF56219        + More
SSF54928   SSF54928       
SSF75689   SSF75689       
SSF100966   SSF100966       
SSF50978   SSF50978       
SSF53822   SSF53822       
Gene 3D

Ontologies

Topology

Length:
305
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
3e-05
Exp number, first 60 AAs:
0
Total prob of N-in:
0.01808
outside
1  -  305
 
 

Population Genetic Test Statistics

Pi
44.737754
Theta
62.982581
Tajima's D
-1.044812
CLR
0
CSRT
0.128343582820859
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号